Active Recombinant Mouse Ntf5 Protein (131 aa)

Cat.No. : Ntf5-323N
Product Overview : Recombinant mouse Neurotrophin-4 (rmNT-4) produced in E. coli is a noncovalently linked homodimer containing two non-glycosylated polypeptide chainsof 131 amino acids. A fully biologically active molecule, rmNT-4 has a molecular mass of 14.0kDaanalyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Protein Length : 131
Description : Neurotrophin-4 (NT-4) is a small secreted cytokine, and belongs to the Neurotrophin (NT) family, which also includes Brain Derived Neurotropic Factor (BDNF), Nerve Growth Factor (NGF), and NT-3. NT family members are all derived from similar sized protein precursors, composed of N-terminal propeptides and C-terminal mature domains, which are separated by posttranslational proteolytic cleavage. NT-4 (along with NT-3) is foundin the brains of mammals. In vivo, NT-4 binds to the common receptor, p75NTR, and a tyrosine kinase receptor, TrkB. The heterotrimeric complex activates the NFκB transcription factor. NT-4 is essential for the differentiation and wiring regulation of the central and peripheral nervous systems during development, and is related to important diseases including Alzheimer's.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 1 μg/mL, measured by a cell proliferation assay usingC6cells, corresponding to a specific activity of>1 × 10^3 units/mg.
Molecular Mass : 14.0 kDa, observed by reducing SDS-PAGE.
AA Sequence : MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGEanalysis.
Storage : Lyophilized recombinant mouse Neurotrophin-4 (rmNT-4) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmNT-4 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 50mM acetic acid.
Reconstitution : Reconstituted in 50mM acetic acid or ddH2O at 100 μg/mL.
Gene Name Ntf5 neurotrophin 5 [ Mus musculus (house mouse) ]
Official Symbol Ntf5
Synonyms Ntf5; neurotrophin 5; NT4; NT-4; NT-5; Ntf4; NT4/5; Ntf-5; 2900040K06Rik; neurotrophin-4; neutrophic factor 4
Gene ID 78405
mRNA Refseq NM_198190
Protein Refseq NP_937833
UniProt ID Q80VU4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ntf5 Products

Required fields are marked with *

My Review for All Ntf5 Products

Required fields are marked with *

0
cart-icon
0
compare icon