Species : |
Mouse |
Source : |
E.coli |
Protein Length : |
131 |
Description : |
Neurotrophin-4 (NT-4) is a small secreted cytokine, and belongs to the Neurotrophin (NT) family, which also includes Brain Derived Neurotropic Factor (BDNF), Nerve Growth Factor (NGF), and NT-3. NT family members are all derived from similar sized protein precursors, composed of N-terminal propeptides and C-terminal mature domains, which are separated by posttranslational proteolytic cleavage. NT-4 (along with NT-3) is foundin the brains of mammals. In vivo, NT-4 binds to the common receptor, p75NTR, and a tyrosine kinase receptor, TrkB. The heterotrimeric complex activates the NFκB transcription factor. NT-4 is essential for the differentiation and wiring regulation of the central and peripheral nervous systems during development, and is related to important diseases including Alzheimer's. |
Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : |
ED50 < 1 μg/mL, measured by a cell proliferation assay usingC6cells, corresponding to a specific activity of>1 × 10^3 units/mg. |
Molecular Mass : |
14.0 kDa, observed by reducing SDS-PAGE. |
AA Sequence : |
MGVSETAPASRRGELAVCDAVSGWVTDRRTAVDLRGREVEVLGEVPAAGGSPLRQYFFETRCKAESAGEGGPGVGGGGCRGVDRRHWLSECKAKQSYVRALTADSQGRVGWRWIRIDTACVCTLLSRTGRA |
Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
Purity : |
> 95% by SDS-PAGEanalysis. |
Storage : |
Lyophilized recombinant mouse Neurotrophin-4 (rmNT-4) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rmNT-4 remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : |
Lyophilized after extensive dialysis against 50mM acetic acid. |
Reconstitution : |
Reconstituted in 50mM acetic acid or ddH2O at 100 μg/mL. |