Active Recombinant Mouse Prolactin / Prl Protein
| Cat.No. : | Prl-5130M |
| Product Overview : | Purified recombinant protein of Mouse prolactin (Prl), transcript variant 1 without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | Non |
| Protein Length : | 31-228 a.a. |
| Description : | Low expression observed in reference dataset. |
| Bio-activity : | Determined by its ability to induce the proliferation of rat Nb2-11 cells in the concentration range of 0.1-1.0 ng/mL. |
| Molecular Mass : | 22.5 kDa |
| AA Sequence : | MLPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC |
| Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
| Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. |
| Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
| Gene Name | Prl prolactin [ Mus musculus (house mouse) ] |
| Official Symbol | Prl |
| Synonyms | PRL; prolactin; Prl1a1; AV290867 |
| Gene ID | 19109 |
| mRNA Refseq | NM_011164 |
| Protein Refseq | NP_035294 |
| UniProt ID | Q9CPQ2 |
| ◆ Recombinant Proteins | ||
| PRL-1193S | Recombinant Sheep PRL Protein, His-tagged | +Inquiry |
| Prl-7819R | Recombinant Rat Prl protein, His & T7-tagged | +Inquiry |
| PRL-4497H | Recombinant Horse PRL protein, hFc-tagged | +Inquiry |
| PRL-106H | Recombinant Human prolactin Protein, His&Flag tagged | +Inquiry |
| PRL-9618Z | Recombinant Zebrafish PRL | +Inquiry |
| ◆ Native Proteins | ||
| PRL-111S | Active Native Sheep Prolactin | +Inquiry |
| PRL-8245H | Native Human Prolactin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Prl Products
Required fields are marked with *
My Review for All Prl Products
Required fields are marked with *
