Active Recombinant Mouse Prolactin / Prl Protein

Cat.No. : Prl-5130M
Product Overview : Purified recombinant protein of Mouse prolactin (Prl), transcript variant 1 without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Tag : Non
Protein Length : 31-228 a.a.
Description : Low expression observed in reference dataset.
Bio-activity : Determined by its ability to induce the proliferation of rat Nb2-11 cells in the concentration range of 0.1-1.0 ng/mL.
Molecular Mass : 22.5 kDa
AA Sequence : MLPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Prl prolactin [ Mus musculus (house mouse) ]
Official Symbol Prl
Synonyms PRL; prolactin; Prl1a1; AV290867
Gene ID 19109
mRNA Refseq NM_011164
Protein Refseq NP_035294
UniProt ID Q9CPQ2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Prl Products

Required fields are marked with *

My Review for All Prl Products

Required fields are marked with *

0
cart-icon
0
compare icon