Active Recombinant Mouse Prolactin / Prl Protein
Cat.No. : | Prl-5130M |
Product Overview : | Purified recombinant protein of Mouse prolactin (Prl), transcript variant 1 without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | Non |
Protein Length : | 31-228 a.a. |
Description : | Low expression observed in reference dataset. |
Bio-activity : | Determined by its ability to induce the proliferation of rat Nb2-11 cells in the concentration range of 0.1-1.0 ng/mL. |
Molecular Mass : | 22.5 kDa |
AA Sequence : | MLPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Prl prolactin [ Mus musculus (house mouse) ] |
Official Symbol | Prl |
Synonyms | PRL; prolactin; Prl1a1; AV290867 |
Gene ID | 19109 |
mRNA Refseq | NM_011164 |
Protein Refseq | NP_035294 |
UniProt ID | Q9CPQ2 |
◆ Recombinant Proteins | ||
PRL-590 | Recombinant Ovine Prolactin Antagonist, 199aa | +Inquiry |
PRL-261H | Recombinant Human PRL, StrepII-tagged | +Inquiry |
PRL-298B | Recombinant Bovine Prolactin Protein, His-Tagged | +Inquiry |
PRL-1195C | Recombinant Chicken PRL Protein, His-tagged | +Inquiry |
PRL-96B | Recombinant Bovine PRL protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
PRL-8245H | Native Human Prolactin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Prl Products
Required fields are marked with *
My Review for All Prl Products
Required fields are marked with *