Active Recombinant Mouse Prolactin / Prl Protein

• Cat.No.: Prl-5130M
• Product Overview: Purified recombinant protein of Mouse prolactin (Prl), transcript variant 1 without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Tag: Non
• Protein Length: 31-228 a.a.
• Description: Low expression observed in reference dataset.
• Bio-activity: Determined by its ability to induce the proliferation of rat Nb2-11 cells in the concentration range of 0.1-1.0 ng/mL.
• Molecular Mass: 22.5 kDa
• AA Sequence: MLPICSAGDCQTSLRELFDRVVILSHYIHTLYTDMFIEFDKQYVQDREFMVKVINDCPTSSLATPEDKEQALKVPPEVLLNLILSLVQSSSDPLFQLITGVGGIQEAPEYILSRAKEIEEQNKQLLEGVEKIISQAYPEAKGNGIYFVWSQLPSLQGVDEESKILSLRNTIRCLRRDSHKVDNFLKVLRCQIAHQNNC
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Prl prolactin [ Mus musculus (house mouse) ]
• Official Symbol: Prl
• Synonyms: PRL; prolactin; Prl1a1; AV290867
• Gene ID: 19109
• mRNA Refseq: NM_011164
• Protein Refseq: NP_035294
• UniProt ID: Q9CPQ2