Recombinant Horse PRL protein, hFc-tagged
| Cat.No. : | PRL-4497H |
| Product Overview : | Recombinant Horse PRL protein(P12420)(31-229aa), fused to C-terminal hFc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Horse |
| Source : | Mammalian Cells |
| Tag : | Fc |
| Protein Length : | 31-229aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 51.9 kDa |
| AA Sequence : | LPICPSGAVNCQVSLRELFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFVTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPEAILSKAIEIEEQNRRLLEGMEKIVGQVQPRIKENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| Gene Name | PRL prolactin [ Equus caballus ] |
| Official Symbol | PRL |
| Synonyms | PRL; prolactin; preprolactin; |
| Gene ID | 100034034 |
| mRNA Refseq | NM_001081896 |
| Protein Refseq | NP_001075365 |
| ◆ Recombinant Proteins | ||
| PRL-4498H | Recombinant Horse PRL protein, His-tagged | +Inquiry |
| PRL-6262H | Recombinant Human PRL Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| PRL-5500P | Recombinant Pig PRL protein, His-tagged | +Inquiry |
| Prl-63M | Active Recombinant Mouse Prolactin / Prl Protein | +Inquiry |
| PRL-1193S | Recombinant Sheep PRL Protein, His-tagged | +Inquiry |
| ◆ Native Proteins | ||
| PRL-8245H | Native Human Prolactin | +Inquiry |
| PRL-111S | Active Native Sheep Prolactin | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *



