Recombinant Horse PRL protein, hFc-tagged
Cat.No. : | PRL-4497H |
Product Overview : | Recombinant Horse PRL protein(P12420)(31-229aa), fused to C-terminal hFc tag, was expressed in Mammalian cell. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Horse |
Source : | Mammalian Cells |
Tag : | Fc |
Protein Length : | 31-229aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.9 kDa |
AA Sequence : | LPICPSGAVNCQVSLRELFDRAVILSHYIHNLSSEMFNEFDKRYAQGRGFVTKAINSCHTSSLSTPEDKEQAQQIHHEDLLNLILRVLRSWNDPLYHLVSEVRGMQEAPEAILSKAIEIEEQNRRLLEGMEKIVGQVQPRIKENEVYSVWSGLPSLQMADEDSRLFAFYNLLHCLRRDSHKIDNYLKLLKCRIVYDSNC |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | PRL prolactin [ Equus caballus ] |
Official Symbol | PRL |
Synonyms | PRL; prolactin; preprolactin; |
Gene ID | 100034034 |
mRNA Refseq | NM_001081896 |
Protein Refseq | NP_001075365 |
◆ Recombinant Proteins | ||
PRL-1195C | Recombinant Chicken PRL Protein, His-tagged | +Inquiry |
PRL-4497H | Recombinant Horse PRL protein, hFc-tagged | +Inquiry |
PRL-2590H | Recombinant Human PRL Protein (Leu29-Cys227), His tagged | +Inquiry |
PRL-106H | Recombinant Human prolactin Protein, His&Flag tagged | +Inquiry |
PRL-54O | Recombinant Ovine Prolactin Antagonist | +Inquiry |
◆ Native Proteins | ||
PRL-8245H | Native Human Prolactin | +Inquiry |
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PRL-524MCL | Recombinant Mouse PRL cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All PRL Products
Required fields are marked with *
My Review for All PRL Products
Required fields are marked with *