Active Recombinant Mouse RANKL Protein, His-Tagged
| Cat.No. : | RANKL-01M |
| Product Overview : | Recombinant mouse RANKL Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Description : | RANKL and RANK are members of the TNF superfamily of ligands and receptors that is critical for the regulation of specific immunity and bone turnover. RANK receptor was originally identified as a dendritic cell-membrane protein, which, by interacting with RANKL, augments the ability of dendritic cells. These dendritic cells then stimulate naïve T-cell proliferation in a mixed lymphocyte reaction, promote the survival of RANK+ T-cells, and regulate T-cell-dependent immune response. RANKL, which is expressed in a variety of cells, including osteoblasts, fibroblasts, activated T-cells and bone marrow stromal cells, is also capable of interacting with a decoy receptor called OPG. |
| Form : | Lyophilized powder |
| AA Sequence : | MPAMMEGSWLDVAQRGKPEAQPFAHLTINAASIPSGSHKVTLSSWYHDRGWAKISNMTLSNGKLRVNQDGFYYLYANICFRHHETSGSV PTDYLQLMVYVVKTSIKIPSSHNLMKGGSTKNWSGNSEFHFYSINVGGFFKLRAGEEISIQVSNPSLLDPDQDATYFGAFKVQDID with polyhistidine tag at the C-terminus |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Bio-activity : | Measure by its ability to induce osteoclast differentiation in RAW264.7 cells. The ED50 for this effect is <2 ng/mL. |
| Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Notes : | Please use within one month after protein reconstitution. |
| ◆ Recombinant Proteins | ||
| RANKL-01M | Active Recombinant Mouse RANKL Protein, His-Tagged | +Inquiry |
| RANkL-3213H | Recombinant Human RANkL protein, His-GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RANKL Products
Required fields are marked with *
My Review for All RANKL Products
Required fields are marked with *



