Active Recombinant Mouse Tnf Protein
Cat.No. : | Tnf-6539M |
Product Overview : | Purified recombinant protein of Mouse tumor necrosis factor (Tnf) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. Members of this family are classified based on primary sequence, function, and structure. This protein is synthesized as a type-II transmembrane protein and is reported to be cleaved into products that exert distinct biological functions. It plays an important role in the innate immune response as well as regulating homeostasis but is also implicated in diseases of chronic inflammation. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
Bio-activity : | The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is less than or equal to 0.1 ng/mL, corresponding to a specific activity of ≥ 1 × 10^7 units/mg. |
Molecular Mass : | 17.3 kDa |
AA Sequence : | MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Tnf tumor necrosis factor [ Mus musculus (house mouse) ] |
Official Symbol | Tnf |
Synonyms | TNF; tumor necrosis factor; TNF-a; TNF alpha; cachectin; tumor necrosis factor alpha; tumor necrosis factor-alpha; tumor necrosis factor ligand superfamily member 2; DIF; Tnfa; TNFSF2; Tnfsf1a; TNFalpha; TNF-alpha; MGC151434 |
Gene ID | 21926 |
mRNA Refseq | NM_013693 |
Protein Refseq | NP_038721 |
UniProt ID | P06804 |
◆ Recombinant Proteins | ||
Tnf-577R | Rat Tnfa Crystal Structure | +Inquiry |
Tnf-108R | Recombinant Rat Tnf, His-tagged | +Inquiry |
TNF-151H | Recombinant Human TNF Protein, His-tagged | +Inquiry |
TNF-213H | Recombinant Human TNF, StrepII-tagged | +Inquiry |
TNF-194H | Recombinant Human Tumor Necrosis Factor | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnf Products
Required fields are marked with *
My Review for All Tnf Products
Required fields are marked with *
0
Inquiry Basket