| Species : |
Mouse |
| Source : |
E.coli |
| Description : |
This gene encodes a multifunctional proinflammatory cytokine that belongs to the tumor necrosis factor (TNF) superfamily. Members of this family are classified based on primary sequence, function, and structure. This protein is synthesized as a type-II transmembrane protein and is reported to be cleaved into products that exert distinct biological functions. It plays an important role in the innate immune response as well as regulating homeostasis but is also implicated in diseases of chronic inflammation. In mouse deficiency of this gene is associated with defects in response to bacterial infection, with defects in forming organized follicular dendritic cell networks and germinal centers, and with a lack of primary B cell follicles. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2013] |
| Bio-activity : |
The ED50 as determined by the cytolysis of murine L929 cells in the presence of actinomycin D is less than or equal to 0.1 ng/mL, corresponding to a specific activity of ≥ 1 × 10^7 units/mg. |
| Molecular Mass : |
17.3 kDa |
| AA Sequence : |
MLRSSSQNSSDKPVAHVVANHQVEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLVYSQVLFKGQGCPDYVLLTHTVSRFAISYQEKVNLLSAVKSPCPKDTPEGAELKPWYEPIYLGGVFQLEKGDQLSAEVNLPKYLDFAESGQVYFGVIAL |
| Endotoxin : |
< 0.1 ng/μg of protein (< 1 EU/μg) |
| Purity : |
> 95% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : |
Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
| Storage : |
Store at -80 centigrade. |
| Storage Buffer : |
LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |