Active Recombinant Mouse TNF-β Protein, His-Tagged 
| Cat.No. : | TNF-β-01M |
| Product Overview : | Recombinant mouse TNF-β Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Description : | TNF-β works as a potential mediator in the inflammatory and immune process. It a component of the TNF family of ligands, and signals through TNFR1 and TNFR2. TNF-β is secreted by activated T and B lymphocytes, and has similar function to TNF-α. In the same manner as TNF-α, TNF-β is involved in the regulation of various biological processes, including cell proliferation, differentiation, apoptosis, lipid metabolism, coagulation, and neurotransmission. TNF-β is generally released as a soluble polypeptide. In addition, lymphotoxin-β can anchor TNF-β to the cell surface and form heterotrimers in an effective manner. TNF-β is cytotoxic to a wide range of tumor cells. |
| Form : | Lyophilized powder |
| AA Sequence : | LSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYL AHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL with polyhistidine tag at the N-terminus |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Bio-activity : | Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED50 for this effect is <30 ng/mL |
| Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 8.0. |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Notes : | Please use within one month after protein reconstitution. |
| Gene Name | Lta lymphotoxin A [ Mus musculus (house mouse) ] |
| Official Symbol | TNF-β |
| Synonyms | LT; Ltx; Tnfb; LT[a]; LT-[a]; TNFSF1; Tnlg1e; hlb382; LTalpha; Tnfsf1b; LT-alpha; TNF-beta |
| Gene ID | 16992 |
| mRNA Refseq | NM_010735.2 |
| Protein Refseq | NP_034865.1 |
| UniProt ID | P09225 |
| ◆ Recombinant Proteins | ||
| TNF-β-01M | Active Recombinant Mouse TNF-β Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TNF-β Products
Required fields are marked with *
My Review for All TNF-β Products
Required fields are marked with *
Recently Viewed
