Active Recombinant Mouse Tnfsf10 Protein

Cat.No. : Tnfsf10-6550M
Product Overview : Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 10 (Tnfsf10) without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.
Bio-activity : Assay#1: Determined by the dose-dependent stimulation of MIP-2 production by mouse spleen cells using a concentration range of 10-100 ng/mL.
Assay#2: Measured by its ability to induce apoptosis in LN-18 cells (human glioblastoma cells). The expected ED50 for this effect is 40.0-60.0 ng/mL.
Molecular Mass : 20 kDa
AA Sequence : MRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN
Endotoxin : < 0.1 ng/μg of protein (< 1 EU/μg)
Purity : > 95% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2
Gene Name Tnfsf10 tumor necrosis factor (ligand) superfamily, member 10 [ Mus musculus (house mouse) ]
Official Symbol Tnfsf10
Synonyms TNFSF10; tumor necrosis factor (ligand) superfamily, member 10; tumor necrosis factor ligand superfamily member 10; TRAIL/APO2L; TNF-related apoptosis inducing ligand; TNF-related apoptosis-inducing ligand; TL2; Ly81; Trail; APO-2L; AI448571; A330042I21Rik
Gene ID 22035
mRNA Refseq NM_009425
Protein Refseq NP_033451
UniProt ID P50592

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfsf10 Products

Required fields are marked with *

My Review for All Tnfsf10 Products

Required fields are marked with *

0
cart-icon
0
compare icon