Active Recombinant Mouse Tnfsf10 Protein
Cat.No. : | Tnfsf10-6550M |
Product Overview : | Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 10 (Tnfsf10) without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis. |
Bio-activity : | Assay#1: Determined by the dose-dependent stimulation of MIP-2 production by mouse spleen cells using a concentration range of 10-100 ng/mL. Assay#2: Measured by its ability to induce apoptosis in LN-18 cells (human glioblastoma cells). The expected ED50 for this effect is 40.0-60.0 ng/mL. |
Molecular Mass : | 20 kDa |
AA Sequence : | MRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN |
Endotoxin : | < 0.1 ng/μg of protein (< 1 EU/μg) |
Purity : | > 95% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2 |
Gene Name | Tnfsf10 tumor necrosis factor (ligand) superfamily, member 10 [ Mus musculus (house mouse) ] |
Official Symbol | Tnfsf10 |
Synonyms | TNFSF10; tumor necrosis factor (ligand) superfamily, member 10; tumor necrosis factor ligand superfamily member 10; TRAIL/APO2L; TNF-related apoptosis inducing ligand; TNF-related apoptosis-inducing ligand; TL2; Ly81; Trail; APO-2L; AI448571; A330042I21Rik |
Gene ID | 22035 |
mRNA Refseq | NM_009425 |
Protein Refseq | NP_033451 |
UniProt ID | P50592 |
◆ Recombinant Proteins | ||
TNFSF10-3603H | Recombinant Human TNFSF10 protein, GST-tagged | +Inquiry |
TNFSF10-17171M | Recombinant Mouse TNFSF10 Protein | +Inquiry |
TNFSF10-5949C | Recombinant Chicken TNFSF10 | +Inquiry |
Tnfsf10-6550M | Active Recombinant Mouse Tnfsf10 Protein | +Inquiry |
RFL33154HF | Recombinant Full Length Human Tumor Necrosis Factor Ligand Superfamily Member 10(Tnfsf10) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNFSF10-892HCL | Recombinant Human TNFSF10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tnfsf10 Products
Required fields are marked with *
My Review for All Tnfsf10 Products
Required fields are marked with *