Active Recombinant Mouse Tnfsf10 Protein

• Cat.No.: Tnfsf10-6550M
• Product Overview: Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 10 (Tnfsf10) without tag was expressed in E. coli.

Specification

• Species: Mouse
• Source: E.coli
• Description: Cytokine that binds to TNFRSF10A/TRAILR1, TNFRSF10B/TRAILR2, TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and possibly also to TNFRSF11B/OPG. Induces apoptosis. Its activity may be modulated by binding to the decoy receptors TNFRSF10C/TRAILR3, TNFRSF10D/TRAILR4 and TNFRSF11B/OPG that cannot induce apoptosis.
• Bio-activity: Assay#1: Determined by the dose-dependent stimulation of MIP-2 production by mouse spleen cells using a concentration range of 10-100 ng/mL.
  Assay#2: Measured by its ability to induce apoptosis in LN-18 cells (human glioblastoma cells). The expected ED50 for this effect is 40.0-60.0 ng/mL.
• Molecular Mass: 20 kDa
• AA Sequence: MRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDKVRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN
• Endotoxin: < 0.1 ng/μg of protein (< 1 EU/μg)
• Purity: > 95% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: LyopH ilized from a 0.2 μM filtered solution of 20 mM pH ospH ate buffer, 100 mM NaCl, pH 7.2

Gene Information

• Gene Name: Tnfsf10 tumor necrosis factor (ligand) superfamily, member 10 [ Mus musculus (house mouse) ]
• Official Symbol: Tnfsf10
• Synonyms: TNFSF10; tumor necrosis factor (ligand) superfamily, member 10; tumor necrosis factor ligand superfamily member 10; TRAIL/APO2L; TNF-related apoptosis inducing ligand; TNF-related apoptosis-inducing ligand; TL2; Ly81; Trail; APO-2L; AI448571; A330042I21Rik
• Gene ID: 22035
• mRNA Refseq: NM_009425
• Protein Refseq: NP_033451
• UniProt ID: P50592