Active Recombinant Mouse Tnfsf13 Protein

Cat.No. : Tnfsf13-155M
Product Overview : Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 13 (Tnfsf13), transcript variant 1 without tag was expressed in E.coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : E.coli
Description : Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. Plays a role in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes.
Bio-activity : Measured by its ability to induce cell proliferation of activated T cells.
Molecular Mass : 21.9 kDa
AA Sequence : MRREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKDSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
Endotoxin : Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
Purity : >95%, as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for at least 6 months from date of receipt under proper storage and handling conditions.
Storage : Store at -80 centigrade.
Storage Buffer : Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
Reconstitution : Resuspend the protein in the desired concentration in proper buffer.
Gene Name Tnfsf13 tumor necrosis factor (ligand) superfamily, member 13 [ Mus musculus (house mouse) ]
Official Symbol Tnfsf13
Synonyms Tnfsf13; tumor necrosis factor (ligand) superfamily, member 13; April; Tall2; Trdl1; Tnlg7b; 2310026N09Rik; tumor necrosis factor ligand superfamily member 13; a proliferation-inducing ligand; tumor necrosis factor ligand 7b
Gene ID 69583
mRNA Refseq NM_023517
Protein Refseq NP_076006
UniProt ID Q9D777

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfsf13 Products

Required fields are marked with *

My Review for All Tnfsf13 Products

Required fields are marked with *

0
cart-icon