Active Recombinant Mouse Tnfsf13 Protein

• Cat.No.: Tnfsf13-155M
• Product Overview: Purified recombinant protein of Mouse tumor necrosis factor (ligand) superfamily, member 13 (Tnfsf13), transcript variant 1 without tag was expressed in E.coli.

Specification

• Species: Mouse
• Source: E.coli
• Protein Length: 50-241 aa
• Description: Cytokine that binds to TNFRSF13B/TACI and to TNFRSF17/BCMA. Plays a role in the regulation of tumor cell growth. May be involved in monocyte/macrophage-mediated immunological processes.
• Bio-activity: Measured by its ability to induce cell proliferation of activated T cells.
• Molecular Mass: 21.9 kDa
• AA Sequence: MRREVSRLQRSGGPSQKQGERPWQSLWEQSPDVLEAWKDGAKSRRRRAVLTQKHKKKHSVLHLVPVNITSKDSDVTEVMWQPVLRRGRGLEAQGDIVRVWDTGIYLLYSQVLFHDVTFTMGQVVSREGQGRRETLFRCIRSMPSDPDRAYNSCYSAGVFHLHQGDIITVKIPRANAKLSLSPHGTFLGFVKL
• Endotoxin: Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg)
• Purity: >95%, as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for at least 6 months from date of receipt under proper storage and handling conditions.
• Storage: Store at -80 centigrade.
• Storage Buffer: Lyophilized from a 0.2 µM filtered solution of 20mM phosphate buffer,100mM NaCl, pH 7.2
• Reconstitution: Resuspend the protein in the desired concentration in proper buffer.

Gene Information

• Gene Name: Tnfsf13 tumor necrosis factor (ligand) superfamily, member 13 [ Mus musculus (house mouse) ]
• Official Symbol: Tnfsf13
• Synonyms: Tnfsf13; tumor necrosis factor (ligand) superfamily, member 13; April; Tall2; Trdl1; Tnlg7b; 2310026N09Rik; tumor necrosis factor ligand superfamily member 13; a proliferation-inducing ligand; tumor necrosis factor ligand 7b
• Gene ID: 69583
• mRNA Refseq: NM_023517
• Protein Refseq: NP_076006
• UniProt ID: Q9D777