Active Recombinant Mouse Tnfsf4 Protein, His-tagged

Cat.No. : Tnfsf4-01M
Product Overview : Recombinant mouse OX40 Ligand (51-198aa), fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : Insect Cells
Tag : His
Protein Length : 51-198aa
Description : Cytokine that binds to TNFRSF4. Co-stimulates T-cell proliferation and cytokine production.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human TNFRSF4.
Molecular Mass : 17.7kDa (157aa)
AA Sequence : SSSPAKDPPIQRLRGAVTRCEDGQLFISSYKNEYQTMEVQNNSVVIKCDGLYIIYLKGSFFQEVKIDLHFREDHNPISIPMLNDGRRIVFTVVASLAFKDKVYLTVNAPDTLCEHLQINDGELIVVQLTPGYCAPEGSYHSTVNQVPL
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 90% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -80 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 1 mg/mL (determined by Bradford assay)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol.
Gene Name Tnfsf4 tumor necrosis factor (ligand) superfamily, member 4 [ Mus musculus (house mouse) ]
Official Symbol Tnfsf4
Synonyms Tnfsf4; tumor necrosis factor (ligand) superfamily, member 4; Ath; OX4; gp3; Ath-; Ath1; Txgp; gp34; Ath-1; CD134; Ox40l; TXGP1; CD134L; OX-40L; Tnlg2b; Txgp1l; tumor necrosis factor ligand superfamily member 4; OX40 ligand; atherosclerosis 1; tax-transcriptionally activated glycoprotein 1 ligand; tumor necrosis factor ligand 2b
Gene ID 22164
mRNA Refseq NM_009452
Protein Refseq NP_033478
UniProt ID P43488

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Tnfsf4 Products

Required fields are marked with *

My Review for All Tnfsf4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon