| Species : |
Mouse |
| Source : |
E.coli |
| Description : |
Thrombopoietin (TPO) is a growth factor that is produced by liver and kidney tissues. TPO binds the TPO receptor (CD110) to promote megakaryocyte maturation, differentiation, and the production of platelets. |
| Bio-activity : |
MO7e cell proliferation, ≤5 ng/mL |
| Molecular Mass : |
Monomer, 18.7 kDa (175 aa) |
| AA Sequence : |
MSPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF |
| Endotoxin : |
≤1 EUs/μg, Kinetic LAL |
| Purity : |
≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : |
12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : |
Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : |
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
| Reconstitution : |
Sterile water at 0.1 mg/mL |
| Shipping : |
Room temperature |
| Instructions : |
Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |