Active Recombinant Mouse TPO Protein
Cat.No. : | TPO-257M |
Product Overview : | Recombinant Mouse TPO Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Description : | Thrombopoietin (TPO) is a growth factor that is produced by liver and kidney tissues. TPO binds the TPO receptor (CD110) to promote megakaryocyte maturation, differentiation, and the production of platelets. |
Bio-activity : | MO7e cell proliferation, ≤5 ng/mL |
Molecular Mass : | Monomer, 18.7 kDa (175 aa) |
AA Sequence : | MSPVAPACDPRLLNKLLRDSHLLHSRLSQCPDVDPLSIPVLLPAVDFSLGEWKTQTEQSKAQDILGAVSLLLEGVMAARGQLEPSCLSSLLGQLSGQVRLLLGALQGLLGTQLPLQGRTTAHKDPNALFLSLQQLLRGKVRFLLLVEGPTLCVRRTLPTTAVPSSTSQLLTLNKF |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Tpo thyroid peroxidase [ Mus musculus (house mouse) ] |
Official Symbol | TPO |
Synonyms | TPO; thyroid peroxidase; |
Gene ID | 22018 |
mRNA Refseq | NM_009417 |
Protein Refseq | NP_033443 |
UniProt ID | P40226 |
◆ Recombinant Proteins | ||
TPO-257M | Active Recombinant Mouse TPO Protein | +Inquiry |
TPO-17261M | Recombinant Mouse TPO Protein | +Inquiry |
TPO-0061H | Recombinant Human TPO Protein | +Inquiry |
TPO-4954HFL | Recombinant Full Length Human TPO, Flag-tagged | +Inquiry |
TPO-053T | Active Recombinant Human TPO Protein (332 aa) | +Inquiry |
◆ Native Proteins | ||
TPO-8266H | Native Human Thyroid Peroxidase | +Inquiry |
TPO-702H | Native Human Thyroid Peroxidase | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPO-442HCL | Recombinant Human TPO cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TPO Products
Required fields are marked with *
My Review for All TPO Products
Required fields are marked with *
0
Inquiry Basket