Active Recombinant Mouse TRAIL Protein, His-Tagged
| Cat.No. : | TRAIL-01M |
| Product Overview : | Recombinant mouse TRAIL Protein, His-tagged was expressed in E. coli cell |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Mouse |
| Source : | E.coli |
| Tag : | His |
| Description : | TRAIL acts as a cytotoxic protein, through activating rapid apoptosis in tumor cells (not in normal cells). TRAIL conducts apoptosis through binding to DR4 and DR5, which are two death-signaling receptors belonging to the TNFR superfamily of transmembrane proteins. These receptor contain a cytoplasmic "death domain", which can initiate the cell's apoptotic process. |
| Form : | Lyophilized powder |
| AA Sequence : | MPRGGRPQKVAAHITGITRRSNSALIPISKDGKTLGQKIESWESSRKGHSFLNHVLFRNGELVIEQEGLYYIYSQTYFRFQEAEDASKMVSKDK VRTKQLVQYIYKYTSYPDPIVLMKSARNSCWSRDAEYGLYSIYQGGLFELKKNDRIFVSVTNEHLMDLDQEASFFGAFLIN with polyhistidine tag at the C-terminus |
| Endotoxin : | <0.1 EU per 1 μg of the protein by the LAL method. |
| Bio-activity : | Measure by its ability to induce cytotoxicity in L929 cells in the presence of actinomycin D. The ED50 for this effect is <1 ng/mL. |
| Purity : | >98% as determined by SDS-PAGE. Ni-NTA chromatography |
| Storage Buffer : | The protein was lyophilized from a solution containing 1X PBS, pH 7.4. |
| Reconstitution : | It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved. |
| Storage : | Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C. |
| Notes : | Please use within one month after protein reconstitution. |
| ◆ Recombinant Proteins | ||
| TRAIL-01M | Active Recombinant Mouse TRAIL Protein, His-Tagged | +Inquiry |
| TRAIL-301416H | Recombinant Human TRAIL protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All TRAIL Products
Required fields are marked with *
My Review for All TRAIL Products
Required fields are marked with *
