| Species : |
Mouse |
| Source : |
E.coli |
| Description : |
Vascular endothelial growth factor A (VEGF-A) is produced by a wide variety of cell types, including tumor and vascular cells. VEGF-A is a mediator of vascular growth, vascular permeability, and plays a role in stimulating vasodilation via nitric oxide-dependent pathways. VEGF-A has several alternatively spliced isoforms, with VEGF-165 being the most abundant. The VEGF-165 isoform is a secreted protein that acts on receptors VEGFR-1 and VEGFR-2 to modulate endothelial cell proliferation and angiogenesis. |
| Bio-activity : |
HUVEC proliferation, ≤10 ng/mL |
| Molecular Mass : |
Dimer, 19.4/38.8 kDa (165/230 aa) |
| AA Sequence : |
MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Endotoxin : |
≤1 EUs/μg, Kinetic LAL |
| Purity : |
≥95%, Reducing and Non-Reducing SDS PAGE |
| Stability : |
12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
| Storage : |
Storage Prior to Reconstitution: -20 centigrade |
| Storage Buffer : |
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
| Reconstitution : |
Sterile water at 0.1 mg/mL |
| Shipping : |
Room temperature |
| Instructions : |
Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |