Active Recombinant Mouse Vegf164 Protein (165 aa)

Cat.No. : Vegfa-146V
Product Overview : Recombinant Mouse Vegf164 Protein (165 aa) without tag was expressed in P. pastoris.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Mouse
Source : P.pastoris
Protein Length : 165
Description : Vascular Endothelial Growth Factor (VEGF) is a potent growth and angiogenic cytokine. It stimulates proliferation and survival of endothelial cells, and promotes angiogenesis and vascular permeability. Expressed in vascularized tissues, Vascular Endothelial Growth Factor (VEGF) plays a prominent role in normal and pathological angiogenesis. Substantial evidence implicates Vascular Endothelial Growth Factor (VEGF) in the induction of tumor metastasis and intra-ocular neovascular syndromes. Vascular Endothelial Growth Factor (VEGF) signals through the three receptors; fms-like tyrosine kinase (flt-1), KDR gene product (the murine homolog of KDR is the flk-1 gene product) and the flt4 gene product.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : Resuspend cells in assay media (Earle Salts 199X Gibco #11150, without h-EGF) containing 10 % HI-FBS and transfer 100 ul/well to assay plate (5,100 cells/well passage#2). Serial dilute murine VEGF in assay media containing 10 % HI-FBS and transfer 100ml/well to cells in assay plate. Final assay volume is 200 ml/well, containing 10 % HI-FBS, and murine VEGF as indicated 89 hours. Add 20 ml of Promega Substrate Cell Titer 96 Aqueous One Solution Reagent to each well, Incubate 37 centigrade and read at OD 490 nm. The ED50 for the effect is typically 4.1 - 6.2 ng/mL.
Molecular Mass : 39kDa, observed by non-reducing SDS-PAGE.
AA Sequence : MAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin : < 1 EU/μg, determined by LAL method.
Purity : > 97% as analyzed by reducing SDS-PAGE
Storage : Lyophilized recombinant mouse Vascular Endothelial Growth Factor A164 (rmVEGF-A164)remains stable up to 12 months at -80 centigrade from date of receipt. Upon reconstitution, rmVEGF-A164 should be stable up to 4 week at 4 centigrade or up to 6 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against 25 mM HEPES and 150 mM NaCl, pH 7.0.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Vegfa vascular endothelial growth factor A [ Mus musculus ]
Official Symbol Vegfa
Synonyms VEGFA; vascular endothelial growth factor A; vascular permeability factor; Vpf; Vegf; Vegf120; Vegf164; Vegf188;
Gene ID 22339
mRNA Refseq NM_001025250
Protein Refseq NP_001020421
UniProt ID Q00731

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Vegfa Products

Required fields are marked with *

My Review for All Vegfa Products

Required fields are marked with *

0
cart-icon