Active Recombinant Mouse Vegfa Protein, His-tagged
Cat.No. : | Vegfa-7377M |
Product Overview : | Recombinant mouse VEGF-A protein, fused to His-tag, was expressed in E. coli and purified by using conventional chromatography techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mouse |
Source : | E.coli |
Tag : | His |
Description : | This gene is a member of the PDGF/VEGF growth factor family. It encodes a heparin-binding protein, which exists as a disulfide-linked homodimer. This growth factor induces proliferation and migration of vascular endothelial cells, and is essential for both physiological and pathological angiogenesis. Disruption of this gene in mice resulted in abnormal embryonic blood vessel formation. This gene is upregulated in many known tumors and its expression is correlated with tumor stage and progression. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. There is also evidence for alternative translation initiation from upstream non-AUG (CUG) codons resulting in additional isoforms. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is antiangiogenic. Expression of some isoforms derived from the AUG start codon is regulated by a small upstream open reading frame, which is located within an internal ribosome entry site. |
Form : | Liquid |
Bio-activity : | Measured in a cell proliferation assay using NIH-3T3 mouse embryonic fibroblast. The ED50 for this effect is 0.5-1.5 ng/mL. Activity Assay 1. Cell line: NIH-3T3 (Mus mosculus/Mouse embryonic fibroblast ) 2. Maintenance Condition: RPMI 1640 containing 10% FBS 3. Assay medium: serum free RPMI 1640 4. Cell density: 2 x 10^4 cells/well (96 well plate, final volume 100 μL) 5. Incubation time: 24 hr (after sample treatment) 6. Concentration range: 1 pg/mL – 1 μg/mL 7. Detection method: BrdU assay |
Molecular Mass : | 16.3 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAPTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPEKCDKPRR |
Purity : | > 90 % by SDS-PAGE |
Stability : | Shelf life: one year from despatch. |
Storage : | Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing. |
Concentration : | 0.5 mg/mL (determined by Bradford assay) |
Storage Buffer : | 20 mM Tris-HCl buffer (pH 8.0) containing 10 % glycerol |
Gene Name | Vegfa vascular endothelial growth factor A [ Mus musculus (house mouse) ] |
Official Symbol | Vegfa |
Synonyms | Vegfa; vascular endothelial growth factor A; V; Veg; Vpf; Vegf; VEGF12; VEGF16; VEGF18; vascular endothelial growth factor A; vascular permeability factor |
Gene ID | 22339 |
mRNA Refseq | NM_001025250 |
Protein Refseq | NP_001020421 |
UniProt ID | Q00731 |
◆ Recombinant Proteins | ||
Vegfa-313M | Recombinant Mouse Vascular Endothelial Growth Factor A | +Inquiry |
VEGFA-7310HAF647 | Recombinant Human VEGFA Protein, None-tagged, Alexa Fluor 647 conjugated | +Inquiry |
VEGFA-4633H | Recombinant Human VEGFA protein, His-Avi-tagged | +Inquiry |
Vegfa-475M | Active Recombinant Mouse Vegfa protein(Met1-Arg190) | +Inquiry |
VEGFA-549HF | Recombinant Human VEGFA Protein, None-tagged, FITC conjugated | +Inquiry |
◆ Native Proteins | ||
VEGFA-31701TH | Native Human VEGFA | +Inquiry |
◆ Cell & Tissue Lysates | ||
VEGFA-522RCL | Recombinant Rat VEGFA cell lysate | +Inquiry |
VEGFA-974HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-969CCL | Recombinant Canine VEGFA cell lysate | +Inquiry |
VEGFA-727HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
VEGFA-655HCL | Recombinant Human VEGFA cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Vegfa Products
Required fields are marked with *
My Review for All Vegfa Products
Required fields are marked with *
0
Inquiry Basket