Active Recombinant Porcine FLT-3 Ligand Protein
Cat.No. : | FLT3-97P |
Product Overview : | Recombinant Porcine FLT-3 Ligand Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Description : | Fms-related tyrosine kinase 3 ligand (FLT-3 ligand) is a growth factor that regulates hematopoietic cell proliferation. FLT-3 ligand signaling is transmitted through the fms-related tyrosine kinase 3 (FLT-3) receptor. FLT-3 ligand promotes the long-term expansion and differentiation of pro-B cells in the presence of interleukin 7 (IL-7) or in combination of IL-7 and interleukin 3 (IL-3). |
Bio-activity : | OCI-AML5 cell proliferation, ED50≤5 ng/mL |
Molecular Mass : | Monomer, 17.3 kDa (with 155 amino acids) |
AA Sequence : | MSPDCSFPHSPISSTFANTIRQLSDYLLQDYPVTVASNLQDDELCGAFWRLVLAQRWMGQLKTVAGSQMQKLLEAVNTEIVFVTSCALQPLPSCLRFVQANISHLLQDTSQQLVALKPWITRRNFSRCLELQCQPDPSTLLPPRSPGALEATSLP |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | FLT3 fms-related tyrosine kinase 3 [ Sus scrofa (pig) ] |
Official Symbol | FLT3 |
Synonyms | FLT3; fms-related tyrosine kinase 3; |
Gene ID | 100515445 |
mRNA Refseq | XM_021065521 |
Protein Refseq | XP_020921180 |
UniProt ID | D2K7D6 |
◆ Recombinant Proteins | ||
FLT3-3434H | Recombinant Human FLT3 protein, His-tagged | +Inquiry |
FLT3-28340TH | Recombinant Human FLT3, His-tagged | +Inquiry |
Flt3-5668M | Recombinant Mouse Flt3 Protein (Gly27-Arg188), C-Fc tagged | +Inquiry |
FLT3-2340H | Recombinant Human FLT3 Protein, MYC/DDK-tagged | +Inquiry |
FLT3-2243HAF488 | Recombinant Human FLT3 Protein, His-tagged, Alexa Fluor 488 conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
FLT3-970MCL | Recombinant Mouse FLT3 cell lysate | +Inquiry |
FLT3-2561HCL | Recombinant Human FLT3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All FLT3 Products
Required fields are marked with *
My Review for All FLT3 Products
Required fields are marked with *