Active Recombinant Porcine IL2 Protein
Cat.No. : | IL2-157P |
Product Overview : | Recombinant Porcine IL2 Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Porcine |
Source : | E.coli |
Description : | Interleukin 2 (IL-2) is an immunomodulatory cytokine that is produced by lymphocytes. IL-2 signals through the IL-2R receptor to induce activated T cell proliferation and promote T cell differentiation. IL-2 also stimulates the proliferation and differentiation of B cells, natural killer cells, monocytes, and macrophages. |
Bio-activity : | CTLL-2 cell proliferation, ED50≤1 ng/mL |
Molecular Mass : | Monomer, 15.3 kDa (with 135 amino acids) |
AA Sequence : | MAPTSSSTKNTKKQLEPLLLDLQLLLKEVKNYENADLSRMLTFKFYMPKQATELKHLQCLVEELKALEGVLNLGQSKNSDSANIKESMNNINVTVLELKGSETSFKCEYDDETVTAVEFLNKWITFCQSIYSTLT |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 10 mM sodium phosphate, pH 7.5 |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | IL2 interleukin 2 [ Sus scrofa (pig) ] |
Official Symbol | IL2 |
Synonyms | IL2; interleukin 2; interleukin-2; T-cell growth factor; IL-2; TCGF; POIL2; |
Gene ID | 396868 |
mRNA Refseq | NM_213861 |
Protein Refseq | NP_999026 |
UniProt ID | P26891 |
◆ Recombinant Proteins | ||
IL2-311H | Recombinant Human IL2 protein | +Inquiry |
IL2-1026H | Recombinant Human IL2 Protein, His-tagged | +Inquiry |
ll2-538M | Recombinant Mouse Interleukin 2, His-tagged | +Inquiry |
IL2-260F | Recombinant Feline IL2 protein | +Inquiry |
IL2-0182H | Active Recombinant Human IL2 protein, Fc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL2-5234HCL | Recombinant Human IL2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL2 Products
Required fields are marked with *
My Review for All IL2 Products
Required fields are marked with *