Active Recombinant Rabbit GHR Protein

• Cat.No.: GHR-1836R
• Product Overview: Recombinant Rabbit GHR extracellular portion was expressed in E. coli.

Specification

• Species: Rabbit
• Source: E.coli
• Tag: Non
• Form: Lyophilized from a concentrated (1mg/ml) solution with 0.0045 mM NaHCO3.
• Bio-activity: Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones.
• Molecular Mass: 28 kDa
• AA Sequence: AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP
• Purity: > 98.0% as determined by SDS-PAGE
• Storage: Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution GHBP Rabbit should be stored at 4 centigrade between 2-7 days and for future use below
• Reconstitution: It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Gene Information

• Gene Name: GHR growth hormone receptor [ Oryctolagus cuniculus ]
• Official Symbol: GHR
• Synonyms: GHR; growth hormone receptor; GH receptor; somatotropin receptor
• Gene ID: 100009325
• mRNA Refseq: NM_001082636
• Protein Refseq: NP_001076105
• UniProt ID: P19941