Active Recombinant Rabbit GHR Protein
Cat.No. : | GHR-1836R |
Product Overview : | Recombinant Rabbit GHR extracellular portion was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rabbit |
Source : | E.coli |
Tag : | Non |
Form : | Lyophilized from a concentrated (1mg/ml) solution with 0.0045 mM NaHCO3. |
Bio-activity : | Evidenced by its ability of forming 2:1 complex with non-primate Growth Hormones. |
Molecular Mass : | 28 kDa |
AA Sequence : | AFSGSEATPATLGRASESVQRVHPGLGTNSSGKPKFTKCRSPELETFSCHWTDGVHHGLKSPGSVQLFYIRRNTQEWTQEWKECPDYVSAGENSCYFNSSYTSIWIPYCIKLTNNGGMVDQKCFSVEEIVQPDPPIGLNWTLLNVSLTGIHADIQVRWEPPPNADVQKGWIVLEYELQYKEVNETQWKMMDPVLSTSVPVYSLRLDKEYEVRVRSRQRSSEKYGEFSEVLYVTLPQMSPFTCEEDFRFP |
Purity : | > 98.0% as determined by SDS-PAGE |
Storage : | Lyophilized Growth Hormone Binding Protein Rabbit although stable at room temperature for 3 weeks, should be stored desiccated below -18 centigrade. Upon reconstitution GHBP Rabbit should be stored at 4 centigrade between 2-7 days and for future use below |
Reconstitution : | It is recommended to reconstitute the lyophilized GHBP Rabbit in sterile 0.4% NaHCO3 pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions. |
Gene Name | GHR growth hormone receptor [ Oryctolagus cuniculus ] |
Official Symbol | GHR |
Synonyms | GHR; growth hormone receptor; GH receptor; somatotropin receptor |
Gene ID | 100009325 |
mRNA Refseq | NM_001082636 |
Protein Refseq | NP_001076105 |
UniProt ID | P19941 |
◆ Recombinant Proteins | ||
GHR-2959R | Recombinant Rhesus macaque GHR protein, His-tagged | +Inquiry |
GHR-555H | Recombinant Human GHR Protein, Biotinylated | +Inquiry |
GHR-1921R | Active Recombinant Rabbit GHR protein, His-tagged | +Inquiry |
GHR-2337H | Recombinant Human GHR Protein (Lys315-Thr574), N-His tagged | +Inquiry |
Ghr-723M | Recombinant Mouse PDS5B Protein(Met 1-Gln 273), His & hFc-tagged | +Inquiry |
◆ Native Proteins | ||
GHR-42H | Active Recombinant Human GHR Homodimer Protein, His&Avi tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GHR-2401MCL | Recombinant Mouse GHR cell lysate | +Inquiry |
GHR-1140RCL | Recombinant Rat GHR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All GHR Products
Required fields are marked with *
My Review for All GHR Products
Required fields are marked with *