Active Recombinant Rat Fgf1 Protein

Cat.No. : Fgf1-4096R
Product Overview : Rat Fgf1 (P61149) partial recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Tag : Non
Description : The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Three alternatively spliced variants encoding different isoforms have been described.
Form : Lyophilized
Bio-activity : Determined by a cell proliferation assay using balb/c 3T3 cells. The expected ED50 is ≤ 0.1 ng/mL, in the presence of 10 μg/mL heparin, corresponding to a specific activity of ≥ 1 x 107 units/mg.
Molecular Mass : 15.9 kDa
AA Sequence : MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD
Endotoxin : Endotoxin level is < 0.1 ng/μg (< 1 EU/μg).
Purity : 95%
Applications : Functional Study
SDS-PAGE
Usage : Activity assay
SDS-PAGE
The optimal working dilution should be determined by the end user.
Storage : Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : Lyophilized from solutions contain no sodiun azide nor carrier protein
Gene Name Fgf1 fibroblast growth factor 1 [ Rattus norvegicus ]
Official Symbol Fgf1
Synonyms FGF1; fibroblast growth factor 1; aFGF; acidic fibroblast growth factor; heparin-binding growth factor 1; Fibroblast growth factor 1 (heparin binding); FGF-1; HBGF1; HBGF-1;
Gene ID 25317
mRNA Refseq NM_012846
Protein Refseq NP_036978

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Fgf1 Products

Required fields are marked with *

My Review for All Fgf1 Products

Required fields are marked with *

0
cart-icon