Active Recombinant Rat Fgf1 Protein
Cat.No. : | Fgf1-4096R |
Product Overview : | Rat Fgf1 (P61149) partial recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | Non |
Description : | The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. Three alternatively spliced variants encoding different isoforms have been described. |
Form : | Lyophilized |
Bio-activity : | Determined by a cell proliferation assay using balb/c 3T3 cells. The expected ED50 is ≤ 0.1 ng/mL, in the presence of 10 μg/mL heparin, corresponding to a specific activity of ≥ 1 x 107 units/mg. |
Molecular Mass : | 15.9 kDa |
AA Sequence : | MFNLPLGNYKKPKLLYCSNGGHFLRILPDGTVDGTRDRSDQHIQLQLSAESAGEVYIKGTETGQYLAMDTEGLLYGSQTPNEECLFLERLEENHYNTYTSKKHAEKNWFVGLKKNGSCKRGPRTHYGQKAILFLPLPVSSD |
Endotoxin : | Endotoxin level is < 0.1 ng/μg (< 1 EU/μg). |
Purity : | 95% |
Applications : | Functional Study SDS-PAGE |
Usage : | Activity assay SDS-PAGE The optimal working dilution should be determined by the end user. |
Storage : | Store at -20 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | Lyophilized from solutions contain no sodiun azide nor carrier protein |
Gene Name | Fgf1 fibroblast growth factor 1 [ Rattus norvegicus ] |
Official Symbol | Fgf1 |
Synonyms | FGF1; fibroblast growth factor 1; aFGF; acidic fibroblast growth factor; heparin-binding growth factor 1; Fibroblast growth factor 1 (heparin binding); FGF-1; HBGF1; HBGF-1; |
Gene ID | 25317 |
mRNA Refseq | NM_012846 |
Protein Refseq | NP_036978 |
◆ Recombinant Proteins | ||
FGF1-11H | Active Recombinant Human FGF1 Protein (Carrier-Ready-To-Use, 140 amino acid) | +Inquiry |
Fgf1-634M | Active Recombinant Mouse Fgf1 | +Inquiry |
Fgf1-056M | Active Recombinant Mouse Fgf1 Protein | +Inquiry |
FGF1-173H | Recombinant Human Fibroblast Growth Factor 1 (acidic, Sf9 Insect Cells Derived) | +Inquiry |
FGF1-26204TH | Recombinant Human FGF1, His-tagged | +Inquiry |
◆ Native Proteins | ||
FGF1-26203TH | Native Human FGF1 | +Inquiry |
FGF1-33B | Active Native Bovine FGF1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FGF1-6252HCL | Recombinant Human FGF1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Fgf1 Products
Required fields are marked with *
My Review for All Fgf1 Products
Required fields are marked with *
0
Inquiry Basket