| Species : |
Rat |
| Source : |
E.coli |
| Protein Length : |
134 |
| Description : |
Interferon gamma (IFN-γ), also known as Type II interferon,is a cytokine produced primarily by T-lymphocytes and natural killer cells. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and activates the IFN-γ/JAK/STAT pathway. IFN-γ signaling promotesbiological functions primarily related to antiviral and antibacterial defense, apoptosis, inflammation, and regulation of innate and acquired immune responses. While IFN-γ–induced inflammatory cascades summon a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 0.5 ng/mL, measured by cytotoxicity assay using WEHI-279 cells, corresponding to a specific activity of >2 × 10^6 units/mg. |
| Molecular Mass : |
15.5 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
GTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% as analyzed by SDS-PAGE and HPLC. |
| Storage : |
Lyophilized recombinant Rat IFN-γ remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant Rat IFN-γ should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O or PBS at 100 μg/mL. |