Active Recombinant Rat Ifng Protein (134 aa)
| Cat.No. : | Ifng-378I |
| Product Overview : | Recombinant Rat Interferon gamma (IFN-γ) produced in E. coli is a single non-glycosylated polypeptide chain containing 134 amino acids. A fully biologically active molecule, rrIFN-γ has a molecular mass of 15.5 kDa analyzed by reducing SDS-PAGE and is obtained by chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Protein Length : | 134 |
| Description : | Interferon gamma (IFN-γ), also known as Type II interferon,is a cytokine produced primarily by T-lymphocytes and natural killer cells. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and activates the IFN-γ/JAK/STAT pathway. IFN-γ signaling promotesbiological functions primarily related to antiviral and antibacterial defense, apoptosis, inflammation, and regulation of innate and acquired immune responses. While IFN-γ–induced inflammatory cascades summon a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers. |
| Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : | ED50 < 0.5 ng/mL, measured by cytotoxicity assay using WEHI-279 cells, corresponding to a specific activity of >2 × 10^6 units/mg. |
| Molecular Mass : | 15.5 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : | GTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC |
| Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
| Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
| Storage : | Lyophilized recombinant Rat IFN-γ remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, recombinant Rat IFN-γ should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
| Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
| Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
| Gene Name | Ifng interferon gamma [ Rattus norvegicus ] |
| Official Symbol | Ifng |
| Synonyms | IFNG; interferon gamma; IFN-gamma; IFNG2; |
| Gene ID | 25712 |
| mRNA Refseq | NM_138880 |
| Protein Refseq | NP_620235 |
| UniProt ID | P01581 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ifng Products
Required fields are marked with *
My Review for All Ifng Products
Required fields are marked with *


