Active Recombinant Rat Ifng Protein
Cat.No. : | Ifng-263I |
Product Overview : | Recombinant Rat Ifng Protein without tag was expressed in CHO. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | CHO |
Description : | Interferon-γ (IFN-γ), also known as Type II interferon or immune interferon, is a cytokine produced primarily by T-lymphocytes and natural killer cells. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and sets off IFN-γ/JAK/STAT pathway. IFN-γ signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity. While IFN-γ–induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 2.5 ng/mL, measured by cytotoxicity assay using WEHI-279 cells, corresponding to a specific activity of > 4 × 10^5 units/mg. |
Molecular Mass : | 15-25 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant Rat Interferon gamma (IFN-γ) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrIFN-γ should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O or PBS at 100 μg/mL. |
Gene Name | Ifng interferon gamma [ Rattus norvegicus ] |
Official Symbol | Ifng |
Synonyms | IFNG; interferon gamma; IFN-gamma; IFNG2; |
Gene ID | 25712 |
mRNA Refseq | NM_138880 |
Protein Refseq | NP_620235 |
UniProt ID | P01581 |
◆ Recombinant Proteins | ||
IFNG-2997R | Recombinant Rat IFNG Protein | +Inquiry |
Ifng-42M | Active Recombinant Mouse Ifng Protein (His23-Cys155), C-His tagged, Animal-free, Carrier-free | +Inquiry |
IFNG-5432H | Recombinant Human IFNG protein, His-tagged | +Inquiry |
IFNG-116M | Active Recombinant Mouse IFNG Protein | +Inquiry |
Ifng-009I | Active Recombinant Rat Ifng Protein (135 aa) | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Ifng Products
Required fields are marked with *
My Review for All Ifng Products
Required fields are marked with *
0
Inquiry Basket