Active Recombinant Rat Ifng Protein

Cat.No. : Ifng-263I
Product Overview : Recombinant Rat Ifng Protein without tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : CHO
Description : Interferon-γ (IFN-γ), also known as Type II interferon or immune interferon, is a cytokine produced primarily by T-lymphocytes and natural killer cells. The active form of IFN-γ is an antiparallel dimer that interacts with the receptor IFN-γR1 and sets off IFN-γ/JAK/STAT pathway. IFN-γ signaling does diverse biological functions primarily related to host defense and immune regulation, including antiviral and antibacterial defense, apoptosis, inflammation, and innate and acquired immunity. While IFN-γ–induced inflammatory cascade summons a variety of immune-related cell types, such as macrophages, natural killer (NK) cells and cytotoxic T lymphocytes (CTLs), IFN-γ is also implicated in resistance to NK cell and CTL responses and in immune escape in a variety of cancers.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 2.5 ng/mL, measured by cytotoxicity assay using WEHI-279 cells, corresponding to a specific activity of > 4 × 10^5 units/mg.
Molecular Mass : 15-25 kDa, observed by non-reducing SDS-PAGE.
AA Sequence : QGTLIESLESLKNYFNSSSMDAMEGKSLLLDIWRNWQKDGNTKILESQIISFYLRLFEVLKDNQAISNNISVIESHLITNFFSNSKAKKDAFMSIAKFEVNNPQIQHKAVNELIRVIHQLSPESSLRKRKRSRC
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Rat Interferon gamma (IFN-γ) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrIFN-γ should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Ifng interferon gamma [ Rattus norvegicus ]
Official Symbol Ifng
Synonyms IFNG; interferon gamma; IFN-gamma; IFNG2;
Gene ID 25712
mRNA Refseq NM_138880
Protein Refseq NP_620235
UniProt ID P01581

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Ifng Products

Required fields are marked with *

My Review for All Ifng Products

Required fields are marked with *

0
cart-icon
0
compare icon