Active Recombinant Rat IL-3β Protein
Cat.No. : | IL3-170R |
Product Overview : | Recombinant Rat IL-3β Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Description : | Interleukin 3 beta (IL-3 β) is a cytokine that is produced by activated T cells and mast cells. IL-3 β induces the differentiation of hematopoietic stem cells into myeloid precursor cells, such as erythrocyte, megakaryocyte, granulocyte, monocyte, and dendritic cells. IL-3 β also functions in the nervous system and is important during the B-1 cell regulation of chronic inflammatory diseases. |
Bio-activity : | NFS-60 cell proliferation, ED50≤10 ng/mL |
Molecular Mass : | Monomer, 16.3 kDa (with 144 amino acids) |
AA Sequence : | MISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC |
Endotoxin : | ≤1 EUs/μg, Kinetic LAL (50% confidence) |
Purity : | ≥95%, Reducing and Non-Reducing SDS PAGE |
Stability : | 12 months from date of receipt when stored at -20 to -80 centigrade as supplied. 1 month when stored at 4 centigrade after reconstituting as directed. 3 months when stored at -20 to -80 centigrade after reconstituting as directed. |
Storage : | Storage Prior to Reconstitution: -20 centigrade |
Storage Buffer : | Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA) |
Reconstitution : | Sterile water at 0.1 mg/mL |
Shipping : | Room temperature |
Instructions : | Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws. |
Gene Name | Il3 interleukin 3 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | IL3 |
Synonyms | IL3; interleukin 3; interleukin-3; IL-3; MCGF; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor; |
Gene ID | 24495 |
mRNA Refseq | NM_031513 |
Protein Refseq | NP_113701 |
UniProt ID | P04823 |
◆ Recombinant Proteins | ||
Il3-644M | Active Recombinant Mouse Il3 | +Inquiry |
IL3-407D | Recombinant Canine IL3 protein | +Inquiry |
Il3-4682M | Recombinant Mouse Il3 protein, His-tagged | +Inquiry |
IL3-08H | Recombinant Human IL3 protein | +Inquiry |
IL3-5192H | Recombinant Human IL3 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All IL3 Products
Required fields are marked with *
My Review for All IL3 Products
Required fields are marked with *