Active Recombinant Rat Il10 Protein (161 aa)

Cat.No. : Il10-371I
Product Overview : Recombinant rat Interleukin-10 (IL-10)produced in E. coli is a single non-glycosylated polypeptide chain containing 161 amino acids. A fully biologically active molecule, recombinant rat Interleukin-10 (IL-10) has a molecular mass of 18.7kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 161
Description : Interleukin-10 (IL-10), also known as cytokine synthesis inhibitory factor (CSIF), is an anti-inflammatory cytokine produced by a variety of cell lines including T-cells, macrophages and mast cells. IL-10 is classified as a class-2 cytokine, a set of cytokines including IL-19, IL-20, IL-22, IL-24, and IL-26. IL-10 can inhibit the synthesis of pro-inflammatory cytokines such as IFN-gamma, IL-2, IL-3, TNF and GM-CSF. It also stimulates Th2 responses, but suppresses the antigen-presentation capacity of antigen presenting cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 0.5 μg/mL, measured by a cell proliferation assay using C6 cells, corresponding to a specific activity of > 2.0 × 10^3 units/mg.
Molecular Mass : 18.7 kDa, observed by reducing SDS-PAGE.
AA Sequence : MSKGHSIKGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNIVLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% by SDS-PAGE and HPLC analyses.
Storage : Lyophilized recombinant rat Interleukin-10 (IL-10) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, IL-10 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O at 100 μg/mL.
Gene Name Il10 interleukin 10 [ Rattus norvegicus ]
Official Symbol Il10
Synonyms IL10; interleukin 10; interleukin-10; CSIF; IL-10; cytokine synthesis inhibitory factor; IL10X;
Gene ID 25325
mRNA Refseq NM_012854
Protein Refseq NP_036986
UniProt ID P29456

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il10 Products

Required fields are marked with *

My Review for All Il10 Products

Required fields are marked with *

0
cart-icon