| Species : |
Rat |
| Source : |
E.coli |
| Protein Length : |
161 |
| Description : |
Interleukin-10 (IL-10), also known as cytokine synthesis inhibitory factor (CSIF), is an anti-inflammatory cytokine produced by a variety of cell lines including T-cells, macrophages and mast cells. IL-10 is classified as a class-2 cytokine, a set of cytokines including IL-19, IL-20, IL-22, IL-24, and IL-26. IL-10 can inhibit the synthesis of pro-inflammatory cytokines such as IFN-gamma, IL-2, IL-3, TNF and GM-CSF. It also stimulates Th2 responses, but suppresses the antigen-presentation capacity of antigen presenting cells. |
| Form : |
Sterile Filtered White lyophilized (freeze-dried) powder. |
| Bio-activity : |
ED50 < 0.5 μg/mL, measured by a cell proliferation assay using C6 cells, corresponding to a specific activity of > 2.0 × 10^3 units/mg. |
| Molecular Mass : |
18.7 kDa, observed by reducing SDS-PAGE. |
| AA Sequence : |
MSKGHSIKGDNNCTHFPVSQTHMLRELRAAFSQVKTFFQKKDQLDNIVLTDSLLQDFKGYLGCQALSEMIKFYLVEVMPQAENHGPEIKEHLNSLGEKLKTLWIQLRRCHRFLPCENKSKAVEQVKNDFNKLQDKGVYKAMNEFDIFINCIEAYVTLKMKN |
| Endotoxin : |
< 0.2 EU/μg, determined by LAL method. |
| Purity : |
> 95% by SDS-PAGE and HPLC analyses. |
| Storage : |
Lyophilized recombinant rat Interleukin-10 (IL-10) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, IL-10 should be stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
| Storage Buffer : |
Lyophilized after extensive dialysis against PBS. |
| Reconstitution : |
Reconstituted in ddH2O at 100 μg/mL. |