Active Recombinant Rat Il3β Protein (144 aa)

• Cat.No.: Il3-355I
• Product Overview: Recombinant rat Interleukin-3 beta (rrIL-3 beta) produced in E. coli is a single non-glycosylated polypeptide chain containing of 144 amino acids. A fully biologically active molecule, rrIL-3 beta has a molecular mass of 16.3 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.

Specification

• Species: Rat
• Source: E.coli
• Protein Length: 144
• Description: Interleukin-3 (IL-3) is a pleiotropic cytokine belonging to the interleukin family. IL-3 shares similarities with Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) and IL-5: they all have a four-helix bundle structure, are located on the same chromosomes in both human and mouse, are produced by activated T cells, and share receptors. The IL-3/IL-5/GM-CSF receptor family members are all heterodimeric, composed of a receptor-specific α chain and a common β chain. IL-3 is also called multi-colony stimulating factor since it stimulates the development and colony formation of multiple lineages of hematopoietic cells by activating intracellular pathways such as Ras-Raf-ERK and JAK/STAT. IL-3 inhibits apoptosis and promotes cell survival by targeting the anti-apoptotic bcl-2 gene family.
• Form: Sterile Filtered White lyophilized (freeze-dried) powder.
• Bio-activity: ED50 < 5 ng/mL, measured by a cell proliferation assay using NFS-60 cells, corresponding to a specific activity of > 2 × 10^5 units/mg.
• Molecular Mass: 16.3 kDa, observed by non-reducing SDS-PAGE.
• AA Sequence: MISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC
• Endotoxin: < 0.2 EU/μg, determined by LAL method.
• Purity: > 95% as analyzed by SDS-PAGE and HPLC.
• Storage: Lyophilized recombinant rat Interleukin-3 beta (rrIL-3 beta) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrIL-3 beta remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
• Storage Buffer: Lyophilized after extensive dialysis against PBS.
• Reconstitution: Reconstituted in ddH2O at 100 μg/mL.

Gene Information

• Gene Name: Il3 interleukin 3 [ Rattus norvegicus (Norway rat) ]
• Official Symbol: Il3
• Synonyms: Il3; interleukin 3; interleukin-3; IL-3; MCGF; P-cell-stimulating factor; hematopoietic growth factor; mast cell growth factor; multipotential colony-stimulating factor
• Gene ID: 24495
• mRNA Refseq: NM_031513
• Protein Refseq: NP_113701
• UniProt ID: F1LS41