Active Recombinant Rat Il3β Protein (144 aa)
Cat.No. : | Il3-355I |
Product Overview : | Recombinant rat Interleukin-3 beta (rrIL-3 beta) produced in E. coli is a single non-glycosylated polypeptide chain containing of 144 amino acids. A fully biologically active molecule, rrIL-3 beta has a molecular mass of 16.3 kDa analyzed by non-reducing SDS-PAGE and is obtained by proprietary chromatographic techniques. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 144 |
Description : | Interleukin-3 (IL-3) is a pleiotropic cytokine belonging to the interleukin family. IL-3 shares similarities with Granulocyte-Macrophage Colony-Stimulating Factor (GM-CSF) and IL-5: they all have a four-helix bundle structure, are located on the same chromosomes in both human and mouse, are produced by activated T cells, and share receptors. The IL-3/IL-5/GM-CSF receptor family members are all heterodimeric, composed of a receptor-specific α chain and a common β chain. IL-3 is also called multi-colony stimulating factor since it stimulates the development and colony formation of multiple lineages of hematopoietic cells by activating intracellular pathways such as Ras-Raf-ERK and JAK/STAT. IL-3 inhibits apoptosis and promotes cell survival by targeting the anti-apoptotic bcl-2 gene family. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | ED50 < 5 ng/mL, measured by a cell proliferation assay using NFS-60 cells, corresponding to a specific activity of > 2 × 10^5 units/mg. |
Molecular Mass : | 16.3 kDa, observed by non-reducing SDS-PAGE. |
AA Sequence : | MISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVEC |
Endotoxin : | < 0.2 EU/μg, determined by LAL method. |
Purity : | > 95% as analyzed by SDS-PAGE and HPLC. |
Storage : | Lyophilized recombinant rat Interleukin-3 beta (rrIL-3 beta) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrIL-3 beta remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade. |
Storage Buffer : | Lyophilized after extensive dialysis against PBS. |
Reconstitution : | Reconstituted in ddH2O at 100 μg/mL. |
Gene Name | Il3 interleukin 3 [ Rattus norvegicus (Norway rat) ] |
Official Symbol | Il3 |
Synonyms | Il3; interleukin 3; interleukin-3; IL-3; MCGF; P-cell-stimulating factor; hematopoietic growth factor; mast cell growth factor; multipotential colony-stimulating factor |
Gene ID | 24495 |
mRNA Refseq | NM_031513 |
Protein Refseq | NP_113701 |
UniProt ID | F1LS41 |
◆ Recombinant Proteins | ||
IL3-275H | Recombinant Human Interleukin 3 (Colony-Stimulating Factor, Multiple) | +Inquiry |
Il3-641M | Recombinant Mouse Il3 protein, His & GST-tagged | +Inquiry |
Il3-357I | Active Recombinant Mouse Il3 Protein (135 aa) | +Inquiry |
Il3-591R | Recombinant Rat Interleukin 3 | +Inquiry |
Il3-674M | Recombinant Mouse Il3 protein, hFc-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL3-445RCL | Recombinant Rat IL3 cell lysate | +Inquiry |
IL3-607HCL | Recombinant Human IL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Il3 Products
Required fields are marked with *
My Review for All Il3 Products
Required fields are marked with *
0
Inquiry Basket