Active Recombinant Rat Il3 Protein, His-tagged

Cat.No. : Il3-247I
Product Overview : Recombinant Rat Il3 Protein with a His tag was expressed in CHO.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : CHO
Tag : His
Description : Interleukin-3 (IL-3), also known as MCGF, Multi-CSF, HCGF and P-cell stimulation factor, belongs tothe α-helixfamily of hematopoietic cytokines. It is produced by activated T-cells, mast cells and natural killer cells. IL-3 binds to the IL-3 receptor alpha subunit and recruits the signal-transducing common beta chain. IL-3induced signal transduction results in the survival, differentiation and proliferation of a variety of immune cells, such as macrophages, neutrophils, megakaryocytes, mast cells and hematopoietic stem cells. IL-3 often acts synergistically with other cytokines, such as IL-7, EPO, GM-CSF and IL-6, to exert its simulative function.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 8 ng/mL, measured in a cell proliferation assay using NF S-60 cells.
Molecular Mass : 22-34 kDa, observed by reducing SDS-PAGE.
AA Sequence : ISDRGSDAHHLLRTLDCRTIALEILVKLPYPQVSGLNNSDDKANLRNSTLRRVNLDEFLKSQEEFDSQDTTDIKSKLQKLKCCIPAAASDSVLPGVYNKDLDDFKKKLRFYVIHLKDLQPVSVSRPPQPTSSSDNFRPMTVECHHHHHH
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE.
Storage : Lyophilized recombinant ratInterleukin-3 (IL-3), His remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rat Interleukin-3 (IL-3), His should be stable up to 1 week at 4 centigrade or up to 2 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Il3 interleukin 3 [ Rattus norvegicus ]
Official Symbol Il3
Synonyms IL3; interleukin 3; interleukin-3; IL-3; MCGF; mast cell growth factor; P-cell-stimulating factor; hematopoietic growth factor; multipotential colony-stimulating factor;
Gene ID 24495
mRNA Refseq NM_031513
Protein Refseq NP_113701
UniProt ID F1LS41

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Il3 Products

Required fields are marked with *

My Review for All Il3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon