Active Recombinant Rat Osm Protein (215 aa)

Cat.No. : Osm-319O
Product Overview : Recombinant Rat Oncostatin M (rrOSM) produced in E. coli is a single non-glycosylated polypeptide chain containing 215 amino acids. A fully biologically active molecule, rrOSM has a molecular mass of 24.5 kDa analyzed by reducing SDS-PAGE and is obtained by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Rat
Source : E.coli
Protein Length : 215
Description : Oncostatin M (OSM) is a multifunctional cytokine, and belongs to Interleukin-6 (IL-6) subfamily, which also includes IL-11, leukemia inhibitory factor (LIF), ciliary neurotropic factor, cardiotrophin-1, and novel neurotropin-1. In vivo, OSM is secreted from activated T cells, monocytes, neutrophils, and endothelial cells. OSM is related to LIF, and shares a receptor with LIF in human. Human OSM can bind to gp130 and recruit OSM Receptor β or LIF Receptor β to form a ternary complex. OSM stimulates the growth of different types of cells, including megakaryocytes, fibroblasts, vascular endothelial cells, and T cells. OSM inhibits the proliferation of several cancer cell lines, such as solid tissue tumor cells, lung cancer cells, melanoma cells, and breast cancer cells.
Form : Sterile Filtered White lyophilized (freeze-dried) powder.
Bio-activity : ED50 < 10 ng/mL, measured by a cell proliferation assay using Rat Embryo Brain cells, corresponding to a specific activity of > 1 × 10^5 units/mg.
Molecular Mass : 24.5 kDa, observed by reducing SDS-PAGE.
AA Sequence : MKRGCSSSSPKLLSQLKSQANITGNTASLLEPYILHQNLNTLTLRAACTEHPVAFPSEDMLRQLSKPDFLSTVHATLGRVWHQLGAFRQQFPKIQDFPELERARQNIQGIRNNVYCMARLLHPPLEIPEPTQADSGTSRPTTTAPGIFQIKIDSCRFLWGYHRFMGSVGRVFEEWGDGSRRSRRHSPLWAWLKGDHRIRPSRSSQSAMLRSLVPR
Endotoxin : < 0.2 EU/μg, determined by LAL method.
Purity : > 95% as analyzed by SDS-PAGE and HPLC.
Storage : Lyophilized recombinant Rat Oncostatin M (rrOSM) remains stable up to 6 months at -80 centigrade from date of receipt. Upon reconstitution, rrOSM remains stable up to 2 weeks at 4 centigrade or up to 3 months at -20 centigrade.
Storage Buffer : Lyophilized after extensive dialysis against PBS.
Reconstitution : Reconstituted in ddH2O or PBS at 100 μg/mL.
Gene Name Osm oncostatin M [ Rattus norvegicus ]
Official Symbol Osm
Synonyms OSM; oncostatin M;
Gene ID 289747
mRNA Refseq NM_001006961
Protein Refseq NP_001006962
UniProt ID Q65Z15

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All Osm Products

Required fields are marked with *

My Review for All Osm Products

Required fields are marked with *

0
cart-icon