Active Recombinant Rat Tnf Protein (157 aa)
Cat.No. : | Tnf-003T |
Product Overview : | Recombinant Rat Tnf Protein without tag was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Protein Length : | 157 |
Description : | Tumor necrosis factor alpha (TNF-α), also called cachectin, is produced by neutrophils, activated lymphocytes, macrophages, NK cells, LAK cells, astrocytes endothelial cells, smooth muscle cells and some transformed cells. TNF-α occurs as a secreted, soluble form and as a membrane-anchored form, both of which are biologically active. The naturally-occurring form of TNF-α is glycosylated, but non-glycosylated recombinant TNF-α has comparable biological activity. The biologically active native form of TNF-α is reportedly a trimer. Two types of receptors for TNF-α have been described and virtually all cell types studied show the presence of one or both of these receptor types. |
Form : | Sterile Filtered White lyophilized (freeze-dried) powder. |
Bio-activity : | Fully biologically active when compared to standard. The Specific Activity is ≥5.0 × 10^7 IU/mg as determined by the cytolysis of murine L929 cells in the presence of Actinomycin D. |
Molecular Mass : | Approximately 17.3 kDa. a single, non-glycosylated polypeptide chain containing 157 amino acids. |
AA Sequence : | MLRSSSQNSSDKPVVHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYSQVLFKGQGCPDYVLLTHTVSRFATSYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLGGVSQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL |
Endotoxin : | Less than 1 EU/mg of rRtTNF-α as determined by LAL method. |
Purity : | >95% by SDS-PAGE and HPLC analyses. |
Storage : | This lyophilized preparation is stable at 2-8 centigrade, but should be kept at -20 centigrade for long term storage, preferably desiccated. Upon reconstitution, the preparation is stable for up to one week at 2-8 centigrade. For maximal stability, apportion the reconstituted preparation into working aliquots and store at -20 to -70 centigrade. Avoid repeated freeze/thaw cycles. |
Storage Buffer : | Lyophilized from a 0.2mm filtered concentrated solution in 20mM PB, pH7.2, 150mM NaCl. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/ml. Stock solutions should be apportioned into working aliquots and stored at < -20 centigrade. Further dilutions should be made in appropriate buffered solutions. |
Gene Name | Tnf tumor necrosis factor [ Rattus norvegicus ] |
Official Symbol | Tnf |
Synonyms | TNF; tumor necrosis factor; cachectin; tumor necrosis factor alpha; tumor necrosis factor (TNF superfamily, member 2); tumor necrosis factor ligand superfamily member 2; Tnfa; RATTNF; TNF-alpha; MGC124630; |
Gene ID | 24835 |
mRNA Refseq | NM_012675 |
Protein Refseq | NP_036807 |
UniProt ID | P16599 |
◆ Recombinant Proteins | ||
Tnf-484M | Recombinant Mouse Tnf protein | +Inquiry |
Tnf-308M | Recombinant Active Mouse TNF Protein, His-tagged(C-ter) | +Inquiry |
Tnf-01M | Active Recombinant Mouse Tnf Protein, His-Tagged | +Inquiry |
Tnf-564R | Recombinant Rat Tnf protein, His-tagged | +Inquiry |
TNF-3597B | Recombinant Bovine TNF protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TNF-897HCL | Recombinant Human TNF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tnf Products
Required fields are marked with *
My Review for All Tnf Products
Required fields are marked with *
0
Inquiry Basket