Active Recombinant SARS-CoV S Protein, His-tagged

Cat.No. : S-029S
Product Overview : Recombinant SARS-CoV spike RBD protein fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : SARS-CoV
Source : HEK293
Tag : His
Description : May down-regulate host tetherin (BST2) by lysosomal degradation, thereby counteracting its antiviral activity.
Form : Liquid
Bio-activity : Measured by its binding ability in a functional ELISA with Human ACE-2.
Molecular Mass : 24.8 kDa
AA Sequence : RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKL
Endotoxin : < 1 EU/μg of protein (determined by LAL method)
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE, Bioactivity
Storage : Can be stored at +2 to +8 centigrade for 1 week. For long term storage, aliquot and store at -20 to -108 centigrade. Avoid repeated freezing and thawing cycles.
Concentration : 0.5 mg/mL (determined by Absorbance at 280nm)
Storage Buffer : Phosphate-Buffered Saline (pH 7.4) containing 10% glycerol
Gene Name S spike glycoprotein [ SARS coronavirus Tor2 ]
Official Symbol S
Synonyms S; spike glycoprotein; E2; spike glycoprotein
Gene ID 1489668
Protein Refseq NP_828851.1
UniProt ID P59594

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S Products

Required fields are marked with *

My Review for All S Products

Required fields are marked with *

0
cart-icon