Recombinant Human MESDC2 Protein, His tagged

• Cat.No.: MESDC2-3403H
• Product Overview: Recombinant Human MESDC2 Protein with His tag was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 34-234 aa
• Description: Predicted to enable low-density lipoprotein particle receptor binding activity. Involved in ossification and protein folding. Located in endoplasmic reticulum. Implicated in osteogenesis imperfecta type 20.
• Tag: N-His
• Molecular Mass: 25 kDa
• AA Sequence: MGSSHHHHHHSSGLVPRGSHMAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL
• Endotoxin: < 1 EU/μg by LAL
• Purity: > 90% by SDS-PAGE
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Sterile PBS, pH7.4, 10% Glycerol
• Concentration: 1.15 mg/mL by BCA

Gene Information

• Gene Name: MESD mesoderm development LRP chaperone [ Homo sapiens (human) ]
• Official Symbol: MESD
• Synonyms: MESDC2; mesoderm development candidate 2; LDLR chaperone MESD; BOCA; KIAA0081; MESD; mesoderm development protein; renal carcinoma antigen NY-REN-61
• Gene ID: 23184
• mRNA Refseq: NM_015154
• Protein Refseq: NP_055969
• MIM: 607783
• UniProt ID: Q14696