Recombinant Human MESDC2 Protein, His tagged
Cat.No. : | MESDC2-3403H |
Product Overview : | Recombinant Human MESDC2 Protein with His tag was expressed in E. coli. |
Availability | July 12, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 34-234 aa |
Description : | Predicted to enable low-density lipoprotein particle receptor binding activity. Involved in ossification and protein folding. Located in endoplasmic reticulum. Implicated in osteogenesis imperfecta type 20. |
Tag : | N-His |
Molecular Mass : | 25 kDa |
AA Sequence : | MGSSHHHHHHSSGLVPRGSHMAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL |
Endotoxin : | < 1 EU/μg by LAL |
Purity : | > 90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Sterile PBS, pH7.4, 10% Glycerol |
Concentration : | 1.15 mg/mL by BCA |
Gene Name | MESD mesoderm development LRP chaperone [ Homo sapiens (human) ] |
Official Symbol | MESD |
Synonyms | MESDC2; mesoderm development candidate 2; LDLR chaperone MESD; BOCA; KIAA0081; MESD; mesoderm development protein; renal carcinoma antigen NY-REN-61 |
Gene ID | 23184 |
mRNA Refseq | NM_015154 |
Protein Refseq | NP_055969 |
MIM | 607783 |
UniProt ID | Q14696 |
◆ Recombinant Proteins | ||
MESDC2-3403H | Recombinant Human MESDC2 Protein, His tagged | +Inquiry |
Mesd-7410M | Recombinant Mouse Mesd Protein, His-tagged | +Inquiry |
MESD-6142HF | Recombinant Full Length Human MESD Protein, GST-tagged | +Inquiry |
MESD-4434H | Recombinant Human MESD Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MESD Products
Required fields are marked with *
My Review for All MESD Products
Required fields are marked with *