Recombinant Human MESDC2 Protein, His tagged

Cat.No. : MESDC2-3403H
Product Overview : Recombinant Human MESDC2 Protein with His tag was expressed in E. coli.
Availability November 20, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 34-234 aa
Description : Predicted to enable low-density lipoprotein particle receptor binding activity. Involved in ossification and protein folding. Located in endoplasmic reticulum. Implicated in osteogenesis imperfecta type 20.
Tag : N-His
Molecular Mass : 25 kDa
AA Sequence : MGSSHHHHHHSSGLVPRGSHMAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL
Endotoxin : < 1 EU/μg by LAL
Purity : > 90% by SDS-PAGE
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Storage Buffer : Sterile PBS, pH7.4, 10% Glycerol
Concentration : 1.15 mg/mL by BCA
Gene Name MESD mesoderm development LRP chaperone [ Homo sapiens (human) ]
Official Symbol MESD
Synonyms MESDC2; mesoderm development candidate 2; LDLR chaperone MESD; BOCA; KIAA0081; MESD; mesoderm development protein; renal carcinoma antigen NY-REN-61
Gene ID 23184
mRNA Refseq NM_015154
Protein Refseq NP_055969
MIM 607783
UniProt ID Q14696

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MESD Products

Required fields are marked with *

My Review for All MESD Products

Required fields are marked with *

0
cart-icon
0
compare icon