Recombinant Full Length Human MESD Protein, GST-tagged
Cat.No. : | MESD-6142HF |
Product Overview : | Human MESDC2 full-length ORF ( NP_055969.1, 1 a.a. - 234 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 234 amino acids |
Description : | MESD (Mesoderm Development LRP Chaperone) is a Protein Coding gene. Diseases associated with MESD include Autosomal Dominant Nocturnal Frontal Lobe Epilepsy 2. Among its related pathways are Wnt / Hedgehog / Notch. |
Molecular Mass : | 52.5 kDa |
AA Sequence : | MAASRWARKAVVLLCASDLLLLLLLLPPPGSCAAEGSPGTPDESTPPPRKKKKDIRDYNDADMARLLEQWEKDDDIEEGDLPEHKRPSAPVDFSKIDPSKPESILKMTKKGKTLMMFVTVSGSPTEKETEEITSLWQGSLFNANYDVQRFIVGSDRAIFMLRDGSYAWEIKDFLVGQDRCADVTLEGQVYPGKGGGSKEKNKTKQDKGKKKKEGDLKSRSSKEENRAGNKREDL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MESD mesoderm development LRP chaperone [ Homo sapiens (human) ] |
Official Symbol | MESD |
Synonyms | MESDC2; mesoderm development candidate 2; LDLR chaperone MESD; BOCA; KIAA0081; MESD; mesoderm development protein; renal carcinoma antigen NY-REN-61; |
Gene ID | 23184 |
mRNA Refseq | NM_015154 |
Protein Refseq | NP_055969 |
MIM | 607783 |
UniProt ID | Q14696 |
◆ Recombinant Proteins | ||
MESDC2-3403H | Recombinant Human MESDC2 Protein, His tagged | +Inquiry |
MESD-4434H | Recombinant Human MESD Protein, GST-tagged | +Inquiry |
MESD-6142HF | Recombinant Full Length Human MESD Protein, GST-tagged | +Inquiry |
Mesd-7410M | Recombinant Mouse Mesd Protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MESD Products
Required fields are marked with *
My Review for All MESD Products
Required fields are marked with *