"Fgf7" Related Products

Expand
Expand

Recombinant Mouse Fgf7 protein

Cat.No. : Fgf7-649M
Product Overview : Recombinant Mouse Fgf7 protein was expressed in Escherichia coli.
Description : Murine KGF-1 also known as Fibroblast growth factor 7 (FGF-7), is encoded by the FGF7 gene. KGF-1 only binds to the b splice form of the tyrosine kinase receptor, FGFR2b/KGFR. Affinity between KGF-1 and its receptor can be increased by heparin or heparan sulfate proteoglycan. FGF-10, also called keratinocyte growth factor 2 (KGF-2), shares 51 % amino acid sequence identity and similar function to KGF-1, but uses an additional receptor, FGFR2c. KGF-1 plays an important role in the regulation of embryonic development, cell proliferation and cell differentiation. KGF-1 actives on keratinocytes, and exhibits mitogenic activity for epidermal cells, but essentially no activity for fibroblasts. KGF-1 has species crossactive, murine KGF-1 shares 96 % amino acid sequence identity with human and rat.
Source : E.coli
Species : Mouse
Form : Lyophilized from a 0.2μm filtered solution in 20 mM PB, pH 8.0, 1 M NaCl.
Bio-activity : Fully biologically active when compared to standard. The ED50 as determined by thymidine uptake assay using FGF-receptors transfected BaF3 cells is less than 10 ng/ml, corresponding to a specific activity of > 1.0 × 105 IU/mg.
Molecular Mass : Approximately 18.7 kDa, a single, non-glycosylated polypeptide chain containing 163 amino acids.
Protein length : 163
AA Sequence : CNDMSPEQTATSVNCSSPERHTRSYDYMEGGDIRVRRLFCRTQWYLRIDKRGKVKGTQEMKNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLYAKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGIPVKGKKTKKEQKTAHFLPMAIT
Endotoxin : Less than 1 EU/µg of rMuKGF-1/FGF-7 as determined by LAL method.
Purity : >96% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : Fgf7
Official Symbol : Fgf7
Synonyms : FGF7; fibroblast growth factor 7; FGF-7; HBGF-7; Keratinocyte growth factor; heparin-binding growth factor 7; Kgf;
Gene ID : 14178
mRNA Refseq : NM_008008
Protein Refseq : NP_032034
UniProt ID : P36363

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.