"NRG4" Related Products

Expand
Expand

Recombinant Human NRG4

Cat.No.: NRG4-525H
Product Overview: Recombinant human Neuregulin-4 EGF domain is a disulfide-linked monomeric protein consisting of 62 amino acid residue subunits, and migrates as an approximately 7 kDa protein under non-reducing and reducing conditions in SDS-PAGE. Optimized DNA sequence encoding Human Neuregulin-4 EGF domain was expressed in E. coli.
Description: Neuregulins (NDF, heregulin, GGF ARIA, or SMDF) are EGF- like growth and differentiation factors that signal through tyrosine kinase receptors of the ErbB family. The ErbB2 and ErbB4 receptors cooperate in transmission of neuregulin-1 signals in the heart, whereas ErbB2 and ErbB3 cooperate in neural crest cells.
Source: E. coli
Species: Human
Form: Lyophilized from a 0.2 µm filtered 20 mM phosphate buffer, pH 6.0.
Bio-activity: The ED50 was determined by the phosphorylation of ErbB2 and ErbB4 receptors in CHO cells, and was found to be <3ng/ml, corresponding to a specific activity of 3x 10^5 Units/mg.
Molecular Mass: 7 kDa
AA Sequence: HEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAF
Endotoxin: <0.1 ng/µg (1 EU/µg), using the LAL gel clot method.
Purity: ≥96% by SDS-PAGE and HPLC
Stability: The lyophilized protein is stable for at least 2 years from date of receipt when stored at -20 centigrade. Upon reconstitution, store in working aliquots at +4 centigrade for up to one month, or at -20 centigrade for up to six months, in the presence of a carrier protein. Avoid repeated freeze/thaw cycles.
Reconstitution: Reconstitute at 0.1-1.0 mg/ml in distilled water. This solution can then be diluted into other buffers. To maximize product collection from vial surface, vortex briefly and then spin down to recollect the liquid.
Gene Name: NRG4 neuregulin 4 [ Homo sapiens ]
Official Symbol: NRG4
Synonyms: HRG4; pro-neuregulin-4, membrane-bound isoform; heregulin 4; pro-NRG4
Gene ID: 145957
mRNA Refseq: NM_138573
Protein Refseq: NP_612640
MIM: 610894
UniProt ID: Q8WWG1
Chromosome Location: 15q24.2
Pathway: Adaptive Immune System, organism-specific biosystem; DAP12 interactions, organism-specific biosystem; ErbB receptor signaling network, organism-specific biosystem
Function: growth factor activity; protein binding; receptor binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.