"LASP1" Related Products

Expand
Expand

Recombinant Human LIM And SH3 Protein 1, His-tagged

Cat. No.: LASP1-1386H
Product Overview: Recombinant humanLASP1 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description: LASP1, also known asLIM and SH3 domain protein 1, plays an important role in the regulation ofdynamic actin-based, cytoskeletal activities. Agonist-dependent changes inLASP1 phosphorylation may also serve to regulate actin-associated ion transportactivities, not only in the parietal cell but also in certain otherF-actin-rich secretory epithelial cell types.
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 20% glycerol, 1mM DTT.
Molecular Weight: 32.3 kDa(285aa), confirmed by MALDI-TOF.
Purity: > 80%by SDS - PAGE
Concentration: 0.25mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMNPNCA RCGKIVYPTE KVNCLDKFWH KACFHCETCK MTLNMKNYKGYEKKPYCNAH YPKQSFTMVA DTPENLRLKQ QSELQSQVRY KEEFEKNKGK GFSVVADTPE LQRIKKTQDQISNIKYHEEF EKSRMGPSGG EGMEPERRDS QDGSSYRRPL EQQQPHHIPTSAPVYQQPQQ QPVAQSYGGY KEPAAPVSIQ RSAPGGGGKR YRAVYDYSAA DEDEVSFQDG DTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: LASP1 LIM and SH3 protein 1 [ Homosapiens ]
Official Symbol: LASP1
Synonyms: LASP1; LIM and SH3 protein 1; MLN50;LASP-1; Lasp-1; LIM and SH3 domain protein 1; MLN 50; OTTHUMP00000164238;OTTHUMP00000164239; metastatic lymph node gene 50 protein
Gene ID: 3927
mRNA Refseq: NM_006148
Protein Refseq: NP_006139
MIM: 602920
UniProt ID: Q14847
Chromosome Location: 17q11-q21.3
Function: SH3/SH2 adaptor activity; actin filamentbinding; ion transmembrane transporter activity; metal ion binding; proteinbinding; zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.