Recombinant Human LIM And SH3 Protein 1, His-tagged LASP1-1386H

Recombinant Human LIM And SH3 Protein 1, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human LIM And SH3 Protein 1, His-tagged

Recombinant Human LIM And SH3 Protein 1, His-tagged

LASP1 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : LASP1-1386H
Product Overview : Recombinant humanLASP1 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description : LASP1, also known asLIM and SH3 domain protein 1, plays an important role in the regulation ofdynamic actin-based, cytoskeletal activities. Agonist-dependent changes inLASP1 phosphorylation may also serve to regulate actin-associated ion transportactivities, not only in the parietal cell but also in certain otherF-actin-rich secretory epithelial cell types.
Form : Liquid. 20mMTris-HCl buffer (pH8.0) containing 20% glycerol, 1mM DTT.
Molecular Weight : 32.3 kDa(285aa), confirmed by MALDI-TOF.
Purity : > 80%by SDS - PAGE
Concentration : 0.25mg/ml(determined by Bradford assay)
Sequences of aminoacids : MGSSHHHHHHSSGLVPRGSH MGSHMNPNCA RCGKIVYPTE KVNCLDKFWH KACFHCETCK MTLNMKNYKGYEKKPYCNAH YPKQSFTMVA DTPENLRLKQ QSELQSQVRY KEEFEKNKGK GFSVVADTPE LQRIKKTQDQISNIKYHEEF EKSRMGPSGG EGMEPERRDS QDGSSYRRPL EQQQPHHIPTSAPVYQQPQQ QPVAQSYGGY KEPAAPVSIQ RSAPGGGGKR YRAVYDYSAA DEDEVSFQDG DTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Storage : Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
PDB rendering based on 1zfo. :

Gene Name : LASP1 LIM and SH3 protein 1 [ Homosapiens ]
Official Symbol : LASP1
Synonyms : LASP1; LIM and SH3 protein 1; MLN50;LASP-1; Lasp-1; LIM and SH3 domain protein 1; MLN 50; OTTHUMP00000164238;OTTHUMP00000164239; metastatic lymph node gene 50 protein
Gene ID : 3927
mRNA Refseq : NM_006148
Protein Refseq : NP_006139
MIM : 602920
UniProt ID : Q14847
Chromosome Location : 17q11-q21.3
Function : SH3/SH2 adaptor activity; actin filamentbinding; ion transmembrane transporter activity; metal ion binding; proteinbinding; zinc ion binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy