"LASP1" Related Products

Expand
Expand

Recombinant Human LIM And SH3 Protein 1, His-tagged

Cat. No.: LASP1-1386H
Product Overview: Recombinant humanLASP1 protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description: LASP1, also known asLIM and SH3 domain protein 1, plays an important role in the regulation ofdynamic actin-based, cytoskeletal activities. Agonist-dependent changes inLASP1 phosphorylation may also serve to regulate actin-associated ion transportactivities, not only in the parietal cell but also in certain otherF-actin-rich secretory epithelial cell types.
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 20% glycerol, 1mM DTT.
Molecular Weight: 32.3 kDa(285aa), confirmed by MALDI-TOF.
Purity: > 80%by SDS - PAGE
Concentration: 0.25mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMNPNCA RCGKIVYPTE KVNCLDKFWH KACFHCETCK MTLNMKNYKGYEKKPYCNAH YPKQSFTMVA DTPENLRLKQ QSELQSQVRY KEEFEKNKGK GFSVVADTPE LQRIKKTQDQISNIKYHEEF EKSRMGPSGG EGMEPERRDS QDGSSYRRPL EQQQPHHIPTSAPVYQQPQQ QPVAQSYGGY KEPAAPVSIQ RSAPGGGGKR YRAVYDYSAA DEDEVSFQDG DTIVNVQQIDDGWMYGTVERTGDTGMLPANYVEAI
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: LASP1 LIM and SH3 protein 1 [ Homosapiens ]
Official Symbol: LASP1
Synonyms: LASP1; LIM and SH3 protein 1; MLN50;LASP-1; Lasp-1; LIM and SH3 domain protein 1; MLN 50; OTTHUMP00000164238;OTTHUMP00000164239; metastatic lymph node gene 50 protein
Gene ID: 3927
mRNA Refseq: NM_006148
Protein Refseq: NP_006139
MIM: 602920
UniProt ID: Q14847
Chromosome Location: 17q11-q21.3
Function: SH3/SH2 adaptor activity; actin filamentbinding; ion transmembrane transporter activity; metal ion binding; proteinbinding; zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.