"Adipoq" Related Products

Expand
Expand

Recombinant Mouse Adiponectin, C1Q And Collagen Domain Containing

Cat. No. : Adipoq-5373M
Product Overview : Recombinant MouseAdipoq (aa 111-247) is the globular domain of Mouse Adipoq, containing 138amino acid residues from aa 111-247.
Description : Thereare four distinct regions of Adipoq. The first is ashort signal sequence that targets the hormone for secretion outside thecell; next is a short region that varies between species; the third is a65-amino acid region with similarity to collagenous proteins; the last is aglobular domain. Overall this gene shows similarity to the complement 1Qfactors. However, when the 3-dimensional structure of the globular region wasdetermined, a striking similarity to TNFα was observed, despite unrelatedprotein sequences.
Source : E. coli
Species : Mouse
Form : Liquid in 20 mMTris-HCl, pH 7.5 + 50 mM NaCl + 5 mM DTT + 10% glycerol.
Purity : > 95.0% asdetermined by RP-HPLC and SDS-PAGE analyses.
Endotoxin Level : < 0.1 ng/μg ofAdipoQ.
Amino Acid Sequence : MAYMYRSAFSVGLETRVTVP NVPIRFTKIF YNQQNHYDGS TGKFYCNIPG LYYFSYHITVYMKDVKVSLFKKDKAVLFTY DQYQEKNVDQ ASGSVLLHLE VGDQVWLQVYGDGDHNGLYADNVNDSTFTG FLLYHDTN
Molecular Weight : 16 kDa
Concentration : 1 mg/ml
Storage : Store at -20°C to-80°C. Avoidrepeated freeze-thaw cycles.
OfficialSymbol : Adipoq
PDBrendering based on 1c28. :

Gene Name : Adipoq adiponectin, C1Q andcollagen domain containing [ Mus musculus ]
Synonyms : Adipoq; adiponectin,C1Q and collagen domain containing; APN; Acdc; apM1; 30kDa; GBP28; adipo;Acrp30; adiponectin; OTTMUSP00000050447; adipocyte-specific protein AdipoQ;adipocyte complement related protein; 30 kDa adipocyte complement-relatedprotein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q andcollagen domain containing; adipocyte, C1q and collagen domain-containingprotein
Gene ID : 11450
mRNA Refseq : NM_009605
Protein Refseq : NP_033735
Chromosome Location : 16 B3-B4;16 16.0 cM
Pathway : Adipocytokinesignaling pathway; Adipogenesis; Leptin and adiponectin; PPAR signalingpathway; Type II diabetes mellitus
Function : eukaryotic cellsurface binding; hormone activity; protein binding; protein homodimerizationactivity; receptor binding; sialic acid binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.