Recombinant Mouse Adiponectin, C1Q And Collagen Domain Containing

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Mouse Adiponectin, C1Q And Collagen Domain Containing

Recombinant Mouse Adiponectin, C1Q And Collagen Domain Containing

Adipoq Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : Adipoq-5373M
Product Overview : Recombinant MouseAdipoq (aa 111-247) is the globular domain of Mouse Adipoq, containing 138amino acid residues from aa 111-247.
Description : Thereare four distinct regions of Adipoq. The first is ashort signal sequence that targets the hormone for secretion outside thecell; next is a short region that varies between species; the third is a65-amino acid region with similarity to collagenous proteins; the last is aglobular domain. Overall this gene shows similarity to the complement 1Qfactors. However, when the 3-dimensional structure of the globular region wasdetermined, a striking similarity to TNFα was observed, despite unrelatedprotein sequences.
Source : E. coli
Species : Mouse
Form : Liquid in 20 mMTris-HCl, pH 7.5 + 50 mM NaCl + 5 mM DTT + 10% glycerol.
Purity : > 95.0% asdetermined by RP-HPLC and SDS-PAGE analyses.
Endotoxin Level : < 0.1 ng/μg ofAdipoQ.
Amino Acid Sequence : MAYMYRSAFSVGLETRVTVP NVPIRFTKIF YNQQNHYDGS TGKFYCNIPG LYYFSYHITVYMKDVKVSLFKKDKAVLFTY DQYQEKNVDQ ASGSVLLHLE VGDQVWLQVYGDGDHNGLYADNVNDSTFTG FLLYHDTN
Molecular Weight : 16 kDa
Concentration : 1 mg/ml
Storage : Store at -20°C to-80°C. Avoidrepeated freeze-thaw cycles.
OfficialSymbol : Adipoq
PDBrendering based on 1c28. :

Gene Name : Adipoq adiponectin, C1Q andcollagen domain containing [ Mus musculus ]
Synonyms : Adipoq; adiponectin,C1Q and collagen domain containing; APN; Acdc; apM1; 30kDa; GBP28; adipo;Acrp30; adiponectin; OTTMUSP00000050447; adipocyte-specific protein AdipoQ;adipocyte complement related protein; 30 kDa adipocyte complement-relatedprotein; adipocyte complement-related 30 kDa protein; adipocyte, C1Q andcollagen domain containing; adipocyte, C1q and collagen domain-containingprotein
Gene ID : 11450
mRNA Refseq : NM_009605
Protein Refseq : NP_033735
Chromosome Location : 16 B3-B4;16 16.0 cM
Pathway : Adipocytokinesignaling pathway; Adipogenesis; Leptin and adiponectin; PPAR signalingpathway; Type II diabetes mellitus
Function : eukaryotic cellsurface binding; hormone activity; protein binding; protein homodimerizationactivity; receptor binding; sialic acid binding
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry


  • Note: There will be extra charge for optional service!

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2021 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy