"DUSP18" Related Products

Expand

Recombinant Human Dual Specificity Phosphatase 18, His-tagged

Cat. No.: DUSP18-1923H
Product Overview: Recombinant human DUSP18protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description: DUSP18is a member of the dual-specificity phosphatase (DSP) family, which catalyzesdephosphorylation of phosphotyrosine and phosphothreonine residues. DUSP18 isinhibited by iodoarectic acid and is activated by manganese ions.
Form: Liquid. In 20mMTris-HCl buffer (pH 8.0) containing 1mM DTT, 40% glycerol, 0.1mM PMSF, 1mMEDTA.
Molecular Weight: 23.6 kDa(212aa) confirmed by MALDI-TOF
Purity: > 95%by SDS-PAGE
Concentration: 0.5mg/ml (determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMTAPSC AFPVQFRQPS VSGLSQITKS LYISNGVAAN NKLMLSSNQI TMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPI ADHIHSVEMK QGRTLLHCAA GVSRSAALCL AYLMKYHAMS LLDAHTWTKS CRPIIRPNSGFWEQLIHYEF QLFGKNTVHM VSSPVGMIPD IYEKEVRLMI PL
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: DUSP18 dual specificityphosphatase 18 [ Homo sapiens ]
Official Symbol: DUSP18
Synonyms: DUSP18; dual specificity phosphatase 18;DSP18; DUSP20; LMWDSP20; bK963H5.1; LMW-DSP20; low molecular weight dualspecificity phosphatase 20; EC 3.1.3.16; EC 3.1.3.48
Gene ID: 150290
mRNA Refseq: NM_152511
Protein Refseq: NP_689724
MIM: 611446
UniProt ID: Q8NEJ0
Chromosome Location: 22q12.1
Function: MAP kinase tyrosine/serine/threoninephosphatase activity; hydrolase activity; protein tyrosine phosphataseactivity; protein tyrosine/serine/threonine phosphatase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.