"DUSP18" Related Products

Expand

Recombinant Human Dual Specificity Phosphatase 18, His-tagged

Cat. No.: DUSP18-1923H
Product Overview: Recombinant human DUSP18protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description: DUSP18is a member of the dual-specificity phosphatase (DSP) family, which catalyzesdephosphorylation of phosphotyrosine and phosphothreonine residues. DUSP18 isinhibited by iodoarectic acid and is activated by manganese ions.
Form: Liquid. In 20mMTris-HCl buffer (pH 8.0) containing 1mM DTT, 40% glycerol, 0.1mM PMSF, 1mMEDTA.
Molecular Weight: 23.6 kDa(212aa) confirmed by MALDI-TOF
Purity: > 95%by SDS-PAGE
Concentration: 0.5mg/ml (determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMTAPSC AFPVQFRQPS VSGLSQITKS LYISNGVAAN NKLMLSSNQI TMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPI ADHIHSVEMK QGRTLLHCAA GVSRSAALCL AYLMKYHAMS LLDAHTWTKS CRPIIRPNSGFWEQLIHYEF QLFGKNTVHM VSSPVGMIPD IYEKEVRLMI PL
Storage: Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name: DUSP18 dual specificityphosphatase 18 [ Homo sapiens ]
Official Symbol: DUSP18
Synonyms: DUSP18; dual specificity phosphatase 18;DSP18; DUSP20; LMWDSP20; bK963H5.1; LMW-DSP20; low molecular weight dualspecificity phosphatase 20; EC 3.1.3.16; EC 3.1.3.48
Gene ID: 150290
mRNA Refseq: NM_152511
Protein Refseq: NP_689724
MIM: 611446
UniProt ID: Q8NEJ0
Chromosome Location: 22q12.1
Function: MAP kinase tyrosine/serine/threoninephosphatase activity; hydrolase activity; protein tyrosine phosphataseactivity; protein tyrosine/serine/threonine phosphatase activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.