Recombinant Human Dual Specificity Phosphatase 18, His-tagged DUSP18-1923H

Recombinant Human Dual Specificity Phosphatase 18, His-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human Dual Specificity Phosphatase 18, His-tagged

Recombinant Human Dual Specificity Phosphatase 18, His-tagged

DUSP18 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : DUSP18-1923H
Product Overview : Recombinant human DUSP18protein, fused to His-tag at N-terminus, was expressed in E. coli andpurified by using conventional chromatography.
Description : DUSP18is a member of the dual-specificity phosphatase (DSP) family, which catalyzesdephosphorylation of phosphotyrosine and phosphothreonine residues. DUSP18 isinhibited by iodoarectic acid and is activated by manganese ions.
Form : Liquid. In 20mMTris-HCl buffer (pH 8.0) containing 1mM DTT, 40% glycerol, 0.1mM PMSF, 1mMEDTA.
Molecular Weight : 23.6 kDa(212aa) confirmed by MALDI-TOF
Purity : > 95%by SDS-PAGE
Concentration : 0.5mg/ml (determined by Bradford assay)
Sequences of aminoacids : MGSSHHHHHHSSGLVPRGSH MGSHMTAPSC AFPVQFRQPS VSGLSQITKS LYISNGVAAN NKLMLSSNQI TMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPI ADHIHSVEMK QGRTLLHCAA GVSRSAALCL AYLMKYHAMS LLDAHTWTKS CRPIIRPNSGFWEQLIHYEF QLFGKNTVHM VSSPVGMIPD IYEKEVRLMI PL
Storage : Can bestored at +4°C short term (1-2 weeks). For long term storage, aliquot andstore at -20°C or -70°C. Avoid repeated freezing and thawing cycles.
Gene Name : DUSP18 dual specificityphosphatase 18 [ Homo sapiens ]
Official Symbol : DUSP18
Synonyms : DUSP18; dual specificity phosphatase 18;DSP18; DUSP20; LMWDSP20; bK963H5.1; LMW-DSP20; low molecular weight dualspecificity phosphatase 20; EC 3.1.3.16; EC 3.1.3.48
Gene ID : 150290
mRNA Refseq : NM_152511
Protein Refseq : NP_689724
MIM : 611446
UniProt ID : Q8NEJ0
Chromosome Location : 22q12.1
Function : MAP kinase tyrosine/serine/threoninephosphatase activity; hydrolase activity; protein tyrosine phosphataseactivity; protein tyrosine/serine/threonine phosphatase activity

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy