"Ccl24" Related Products

Expand
Expand
Expand

Recombinant Mouse Ccl24 protein

Cat.No. : Ccl24-475M
Product Overview : Recombinant Mouse Ccl24 protein was expressed in Escherichia coli.
Description : CCL24, also named MPIF-2, Eotaxin-2 and Ckβ6, is a novel CC chemokine recently identified. It is a secreted protein, encoded by CCL24 gene, and produced by activated monocytes and T lymphocytes. CCL24 signals through the CCR3 receptor and has functions of chemotactic activity for resting T-lymphocytes and eosinophils, but none for monocytes and activated lymphocytes. The plasma levels of CCL24 and the aspirin-exacerbated respiratory disease (such as asthma) morbidity rate have positive correlation.
Source : E.coli
Species : Mouse
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 150 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using murine lymphocytes is in a concentration of 10-100 ng/ml.
Molecular Mass : Approximately 10.3 kDa, a single, non-glycosylated polypeptide chain containing 93 amino acids.
Protein length : 93
AA Sequence : VTIPSSCCTSFISKKIPENRVVSYQLANGSICPKAGVIFITKKGHKICTDPKLLWVQRHIQKLDAKKNQPSKGAKAVRTKFAVQRRRGNSTEV
Endotoxin : Less than 1 EU/μg of rMuEotaxin-2/CCL24 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : Ccl24
Official Symbol : Ccl24
Synonyms : CCL24; chemokine (C-C motif) ligand 24; C-C motif chemokine 24; eotaxin-2; CC chemokine CCL24; small inducible cytokine A24; small-inducible cytokine A24; eosinophil chemotactic protein 2; CKb-6; MPIF-2; Scya24;
Gene ID : 56221
mRNA Refseq : NM_019577
Protein Refseq : NP_062523
UniProt ID : Q9JKC0

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.