"CCNA2" Related Products

Expand
Expand

Recombinant Human Cyclin A2, His-tagged

Cat. No.: CCNA2-6798H
Product Overview: Recombinant humanCCNA2 protein, fused to His-tag at N-terminus, was expressed in E.coli andpurified by using conventional chromatography techniques.
Description: CCNA2 belongs to thehighly conserved cyclin family, whose members are characterized by a dramaticperiodicity in protein abundance through the cell cycle. Cyclins function asregulators of CDK kinases. Different cyclins exhibit distinct expression anddegradation patterns which contribute to the temporal coordination of eachmitotic event. In contrast to cyclin A1, which is present only in germ cells,this cyclin is expressed in all tissues tested. This cyclin binds andactivates CDC2 or CDK2 kinases, and thus promotes both cell cycle G1/S andG2/M transitions.
Form: Liquid. 20mMTris-HCl buffer (pH8.0) containing 20% glycerol 0.15M NaCl, 1mM DTT
Molecular Weight: 51.1 kDa (456aa)
Purity: > 90% by SDS -PAGE
Concentration: 0.5 mg/ml(determined by Bradford assay)
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMLGNSA PGPATREAGS ALLALQQTAL QEDQENINPE KAAPVQQPRT RAALAVLKSGNPRGLAQQQRPKTRRVAPLK DLPVNDEHVT VPPWKANSKQ PAFTIHVDEA EKEAQKKPAE SQKIEREDALAFNSAISLPG PRKPLVPLDY PMDGSFESPHTMDMSIVLED EKPVSVNEVP DYHEDIHTYL REMEVKCKPKVGYMKKQPDI TNSMRAILVD WLVEVGEEYK LQNETLHLAV NYIDRFLSSMSVLRGKLQLV GTAAMLLASKFEEIYPPEVA EFVYITDDTY TKKQVLRMEH LVLKVLTFDL AAPTVNQFLT QYFLHQQPANCKVESLAMFLGELSLIDADP YLKYLPSVIA GAAFHLALYT VTGQSWPESL IRKTGYTLES LKPCLMDLHQTYLKAPQHAQ QSIREKYKNS KYHGVSLLNPPETLNL
Storage: Can be stored at+4°C short term (1-2 weeks). For long term storage, aliquot and store at-20°C or -70°C. Avoid repeated freezing and thawing cycles.
Unitprot ID: P20248
Gene Name: CCNA2 cyclin A2 [ Homo sapiens]
Official Symbol: CCNA2
Synonyms: CCNA; CCNA2; CCN1; cyclin-A2;cyclin-A; OTTHUMP00000164087
Gene ID: 890
mRNA Refseq: NM_001237
Protein Refseq: NP_001228
MIM: 123835
Chromosome Location: 4q25-q31
Pathway: APC/C-mediated degradation of cellcycle proteins; ATF-2 transcription factor network; B Cell Receptor SignalingPathway; Cell Cycle, Mitotic; Cell cycle; Cyclin A/B1 associated eventsduring G2/M transition; Cyclin A:Cdk2-associated events at S phase entry; DNAReplication; E2F transcription factor network; G1/S Transition; G2/MTransition; IL2 signaling events mediated by STAT5; Id Signaling Pathway;Orc1 removal from chromatin; Progesterone-mediated oocyte maturation;Regulation of APC/C activators between G1/S and early anaphase
Function: protein binding; protein kinasebinding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.