Recombinant Human CCNA2 protein(31-200 aa), C-His-tagged
Cat.No. : | CCNA2-2688H |
Product Overview : | Recombinant Human CCNA2 protein(P20248)(31-200 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 31-200 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | ENINPEKAAPVQQPRTRAALAVLKSGNPRGLAQQQRPKTRRVAPLKDLPVNDEHVTVPPWKANSKQPAFTIHVDEAEKEAQKKPAESQKIEREDALAFNSAISLPGPRKPLVPLDYPMDGSFESPHTMDMSIILEDEKPVSVNEVPDYHEDIHTYLREMEVKCKPKVGYM |
Gene Name | CCNA2 cyclin A2 [ Homo sapiens ] |
Official Symbol | CCNA2 |
Synonyms | CCNA2; cyclin A2; CCN1, CCNA; cyclin-A2; cyclin-A; CCN1; CCNA; |
Gene ID | 890 |
mRNA Refseq | NM_001237 |
Protein Refseq | NP_001228 |
MIM | 123835 |
UniProt ID | P20248 |
◆ Recombinant Proteins | ||
CCNA2-4115H | Recombinant Human CCNA2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CCNA2-6797C | Recombinant Chicken CCNA2 | +Inquiry |
CCNA2-1400M | Recombinant Mouse CCNA2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CCNA2-9416Z | Recombinant Zebrafish CCNA2 | +Inquiry |
CCNA2-31453TH | Recombinant Human CCNA2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCNA2-7718HCL | Recombinant Human CCNA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CCNA2 Products
Required fields are marked with *
My Review for All CCNA2 Products
Required fields are marked with *