"ORAOV1" Related Products

Recombinant Human Oral Cancer Overexpressed 1, His-tagged

Cat. No.: ORAOV1-5597H
Product Overview: Recombinant humanORAOV1 proetin, fused to His-tag at N-terminus, was expressed in E.coli andpurified by using conventional chromatography techniques.
Description: Oralcancer-overexpressed protein 1 (ORAOV1) was found as a candidate oncogene inthe 11q13 chromosomal region. Functional analyses revealed that ORAOV1 wasinvolved in the regulation of HeLa cell growth through its effect on cellcycle and apoptosis.
Source: E. coli
Species: Human
Form: Liquid. In 20mMTris-HCl buffer (pH 8.0) containing 0.1M NaCl, 10% glycerol.
Molecular Weight: 17.9 Da (161aa),confirmed by MALDI-TOF.
Purity: > 90% by SDS -PAGE.
Concentration: 0.5 mg/ml(determined by Bradford assay).
Sequences of aminoacids: MGSSHHHHHHSSGLVPRGSH MGSHMAGSQD IFDAIVMADE RFHGEGYREG YEEGSSLGVM EGRQHGTLHG AKIGSEIGCYQGFAFAWKCLLHSCTTEKDS RKMKVLESLI GMIQKFPYDD PTYDKLHEDL DKIRGKFKQF CSLLNVQPDFKISAEGSGLS F
Storage: Can be stored at+4°C short term (1-2 weeks). For long term storage, aliquot and store at-20°C or -70°C. Avoid repeated freezing and thawing cycles.
OfficialSymbol: ORAOV1
Gene Name: ORAOV1 oral canceroverexpressed 1 [ Homo sapiens ]
Synonyms: ORAOV1; oral canceroverexpressed 1; TAOS1; oral cancer-overexpressed protein 1; oral canceroverexpressed protein 1-A; tumor-amplified and overexpressed sequence 1
Gene ID: 220064
mRNA Refseq: NM_153451
Protein Refseq: NP_703152
MIM: 607224
UniProt ID: Q8WV07
Chromosome Location: 11q13.2
Function: molecular_function

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.