Recombinant Human PLD2, GST-tagged PLD2-679H

Recombinant Human PLD2, GST-tagged

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Human PLD2, GST-tagged

Recombinant Human PLD2, GST-tagged

PLD2 Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat.No. : PLD2-679H
Product Overview : Recombinant Human PLD2(1 a.a. - 933 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.
Description : The protein encoded by this gene catalyzes the hydrolysis of phosphatidylcholine to phosphatidic acid and choline. The activity of the encoded enzyme is enhanced by phosphatidylinositol 4,5-bisphosphate and ADP-ribosylation factor-1. This protein localizes to the peripheral membrane and may be involved in cytoskeletal organization, cell cycle control, transcriptional regulation, and/or regulated secretion. Two transcript variants encoding different isoforms have been found for this gene.
Source : Wheat germ
Species : Human
Tag : GST
Molecular Mass : 132.3 kDa
AA Sequence : MTATPESLFPTGDELDSSQLQMESDEVDTLKEGEDPADRMHPFLAIYELQSLKVHPLVFAPGVPVTAQVVGTERY TSGSKVGTCTLYSVRLTHGDFSWTTKKKYRHFQELHRDLLRHKVLMSLLPLARFAVAYSPARDAGNREMPSLPRA GPEGSTRHAASKQKYLENYLNCLLTMSFYRNYHAMTEFLEVSQLSFIPDLGRKGLEGMIRKRSGGHRVPGLTCCG RDQVCYRWSKRWLVVKDSFLLYMCLETGAISFVQLFDPGFEVQVGKRSTEARHGVRIDTSHRSLILKCSSYRQAR WWAQEITELAQGPGRDFLQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAILRAQEEIFITDWWLSPEVYLKRP AHSDDWRLDIMLKRKAEEGVRVSILLFKEVELALGINSGYSKRALMLLHPNIKVMRHPDQVTLWAHHEKLLVVDQ VVAFLGGLDLAYGRWDDLHYRLTDLGDSSESAASQPPTPRPDSPATPDLSHNQFFWLGKDYSNLITKDWVQLDRP FEDFIDRETTPRMPWRDVGVVVHGLPARDLARHFIQRWNFTKTTKAKYKTPIYPYLLPKSTSTANQLPFTLPGGQ CTTVQVLRSVDRWSAGTLENSILNAYLHTIRESQHFLYIENQFFISCSDGRTVLNKVGDEIVDRILKAHKQGWCY RVYVLLPLLPGFEGDISTGGGNSIQAILHFTYRTLCRGEYSILHRLKAAMGTAWRDYISICGLRTHGELGGHPVS ELIYIHSKVLIADDRTVIIGSANINDRSLLGKRDSELAVLIEDTETEPSLMNGAEYQAGRFALSLRKHCFGVILG ANTRPDLDLRDPICDDFFQLWQDMAESNANIYEQIFRCLPSNATRSLRTLREYVAVEPLATVSPPLARSELTQVQ GHLVHFPLKFLEDESLLPPLGSKEGMIPLEVWT
Applications : ELISA; WB-Re; AP; Array
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name : PLD2 phospholipase D2 [ Homo sapiens (human) ]
Official Symbol : PLD2
Synonyms : PLD2; phospholipase D2; PLD1C; hPLD2; choline phosphatase 2; phosphatidylcholine-hydrolyzing phospholipase D2; NP_001230037.1; EC 3.1.4.4; NP_002654.3
Gene ID : 5338
mRNA Refseq : NM_002663
Protein Refseq : NP_002654
MIM : 602384
UniProt ID : O14939
Chromosome Location : 17p13.1
Pathway : Alpha-synuclein signaling; Arf6 downstream pathway; Arf6 trafficking events; CDC42 signaling events; EGFR1 Signaling Pathway
Function : N-acylphosphatidylethanolamine-specific phospholipase D activity; phosphatidylinositol binding; phospholipase D activity; protein binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy