"PCSK5" Related Products

Recombinant Human PCSK5, GST-tagged

Cat. No.: PCSK5-121H
Product Overview: Recombinant Human PCSK5was produced in vitro wheat germ expression system with GST-tag at N-terminal,128 kDa (913aa).
Description: Theprotein encoded by this gene belongs to the subtilisin-like proproteinconvertase family. The members of this family are proprotein convertases thatprocess latent precursor proteins into their biologically active products.This encoded protein mediates posttranslational endoproteolytic processingfor several integrin alpha subunits. It is thought to process prorenin,pro-membrane type-1 matrix metalloproteinase and HIV-1 glycoprotein gp160.Multiple transcript variants encoding different isoforms have been found forthis gene.
amino acid sequence: MGWGSRCCCPGRLDLLCVLALLGGCLLPVCRTRVYTNHWAVKIAGGFPEANRIASKYGFINIGQIGALKDYYHFYHSRTIKRSVISSRGT HSFISMEPKVEWIQQQVVKKRTKRDYDFSRAQSTYFNDPKWPSMWYMHCSDNTHPCQSDMNIEGAWKRGYTGKNIVVTILDDGIERT HPDLMQNYDALASCDVNGNDLDPMPRYDASNENKHGTRCAGEVAAAANNSHCTVGIAFNAKIGGVRMLDGDVTDMVEAKSVSFNPQ HVHIYSASWGPDDDGKTVDGPAPLTRQAFENGVRMGRRGLGSVFVWASGNGGRSKDHCSCDGYTNSIYTISISSTAESGKKPWYLEE CSSTLATTYSSGESYDKKIITTDLRQRCTDNHTGTSASAPMAAGIIALALEANPFLTWRDVQHVIVRTSRAGHLNANDWKTNAAGFKVSH LYGFGLMDAEAMVMEAEKWTTVPRQHVCVESTDRQIKTIRPNSAVRSIYKASGCSDNPNRHVNYLEHVVVRITITHPRRGDLAIYLTSPS GTRSQLLANRLFDHSMEGFKNWEFMTIHCWGERAAGDWVLEVYDTPSQLRNFKTPGKLKEWSLVLYGTSVQPYSPTNEFPKVERFRY SRVEDPTDDYGTEDYAGPCDPECSEVGCDGPGPDHCNDCLHYYYKLKNNTRICVSSCPPGHYHADKKRCRKCAPNCESCFGSHGD QCMSCKYGYFLNEETNSCVTHCPDGSYQDTKKNLCRKCSENCKTCTEFHNCTECRDGLSLQGSRCSVSCEDGRYFNGQDCQPCHR FCATCAGAGADGCINCTEGYFMEDGRCVQSCSISYYFDHSSENGYKSCKKCDISCLTCNGPGFKNCTSCPSGYLLDLGMCQMGAICKD ATEESWAEGGFCMLVKKNNLCQRKVLQQLCCKTCTFQG
Source: wheatgerm
Species: Human
Purification: GlutathioneSepharose 4 Fast Flow
Applications: ELISA;WB; Antibody Production; Protein Array
Note: Bestuse within three months from the date of receipt of this protein.
StorageBuffer: 50 mMTris-HCI, 10 mM reduced Glutathione, pH8.0 in the elution buffer.
Storage: Storeat -80°C. Aliquot to avoid repeated freezing and thawing.
OfficialSymbol: PCSK5
Gene Name: PCSK5 proproteinconvertase subtilisin/kexin type 5 [Homo sapiens]
Synonyms: PCSK5; proproteinconvertase subtilisin/kexin type 5; PC5; PC6; PC6A; SPC6; FLJ11149; FLJ16215;hPC6; protease PC6; prohormone convertase 5; proprotein convertase 6; subtilisin/kexin-likeprotease PC5; OTTHUMP00000021497; OTTHUMP00000021498; OTTHUMP00000021499; EC3.4.21.; Proprotein convertase 5; EC 3.4.21; EC 3.4.21.61; EC 3.4.21.75
Gene ID: 5125
mRNA Refseq: NM_006200
Protein Refseq: NP_006191
MIM: 600488
UniProt ID: Q92824
Chromosome Location: 9
Pathway: NGFprocessing; Signal Transduction; Signalling by NGF
Function: peptidaseactivity; peptide binding; serine-type endopeptidase activity

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.