| Cat.No. : | CFP-2906 |
| Product Overview : | The recombinant CFP (Cyan Fluorescent Protein) is expressed in E. coli with an N-terminal His tag and purified by a method that ensures high purity and maximal CFP fluorescence. |
| Source : | E. coli |
| Tag : | His |
| Form : | Freeze dried |
| Molecular Mass : | 31.3kDa |
| AA Sequence : | MSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLAWGIQCFARY PEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRGEVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISD NVYIMPDKANNGLEANFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVLLE SFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR |
| Endotoxin : | <0.1> |
| Purity : | ≥97% by SDS-PAGE and HPLC |
| Applications : | Use as standards for SDS-PAGE, Western blot analysis of CFPtransfected cells, label other proteins, calibration of fluorometers and flow cytometers,fluorescence microscope, or microinjection of CFP into cells and tissues, etc. |
| Storage : | -80 centigrade for long-term storage. |
| Reconstitution : | Reconstitute with dH2O to 1 mg/ml |
Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.
Download Datasheet
See All CFP Products
Download Datasheet