Recombinant Cyan Fluorescent Protein, His-tagged

Cat.No. : CFP-2906
Product Overview : The recombinant CFP (Cyan Fluorescent Protein) is expressed in E. coli with an N-terminal His tag and purified by a method that ensures high purity and maximal CFP fluorescence.
Source : E. coli
Tag : His
Form : Freeze dried
Molecular Mass : 31.3kDa
AA Sequence : MSGGEELFAGIVPVLIELDGDVHGHKFSVRGEGEGDADYGKLEIKFICTTGKLPVPWPTLVTTLAWGIQCFARY PEHMKMNDFFKSAMPEGYIQERTIHFQDDGKYKTRGEVKFEGDTLVNRVELKGEGFKEDGNILGHKLEYSAISD NVYIMPDKANNGLEANFKIRHNIEGGGVQLADHYQTNVPLGDGPVLIPINHYLSCQSAISKDRNEARDHMVLLE SFSAYCHTHGMDELYRSGLRSRAQASNSAVDGTAGPGSTGSR
Endotoxin : <0.1>
Purity : ≥97% by SDS-PAGE and HPLC
Applications : Use as standards for SDS-PAGE, Western blot analysis of CFPtransfected cells, label other proteins, calibration of fluorometers and flow cytometers,fluorescence microscope, or microinjection of CFP into cells and tissues, etc.
Storage : -80 centigrade for long-term storage.
Reconstitution : Reconstitute with dH2O to 1 mg/ml

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.