"SNAI2" Related Products

Expand
Expand
Expand

Recombinant Human SNAI2, GST-tagged

Cat. No.: SNAI2-175H
Product Overview: Recombinant Human SNAI2 (97 a.a. - 169 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
Description: This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.
Source: wheat germ
Molecular Mass: 33.77 kDa
Sequence: KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
Purification: Glutathione Sepharose 4 Fast Flow
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications: ELISA; WB
Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note: Best use within three months from the date of receipt of this protein.
OfficialSymbol: SNAI2
Gene Name: SNAI2 snail homolog 2 (Drosophila) [ Homo sapiens ]
Synonyms: SLUG; WS2D; SLUGH1; SNAIL2; zinc finger protein SNAI2; protein snail homolog 2; neural crest transcription factor SLUG; slug (chicken homolog), zinc finger protein; snail homolog 2 (Drosophila); Neural crest transcription factor Slug; Protein snail homolog 2; slug homolog, zinc finger protein (chicken); SLUGH
Gene ID: 6591
mRNA Refseq: NM_003068
Protein Refseq: NP_003059
MIM: 602150
UniProt ID: O43623
Chromosome Location: 8q11
Pathway: Adherens junction; Direct p53 effectors; Neural Crest Differentiation; Regulation of Wnt-mediated beta catenin signaling and target gene transcription; Signaling events mediated by Stem cell factor receptor (c-Kit)
Function: RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity; chromatin binding; sequence-specific DNA binding; zinc ion binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.