Recombinant Human SNAI2, GST-tagged

Cat.No. : SNAI2-175H
Product Overview : Recombinant Human SNAI2 (97 a.a. - 169 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects.
Molecular Mass : 33.77 kDa
Sequence : KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV
Purification : Glutathione Sepharose 4 Fast Flow
Storage buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Applications : ELISA; WB
Storage : Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note : Best use within three months from the date of receipt of this protein.
OfficialSymbol : SNAI2
Gene Name SNAI2 snail homolog 2 (Drosophila) [ Homo sapiens ]
Synonyms SLUG; WS2D; SLUGH1; SNAIL2; zinc finger protein SNAI2; protein snail homolog 2; neural crest transcription factor SLUG; slug (chicken homolog), zinc finger protein; snail homolog 2 (Drosophila); Neural crest transcription factor Slug; Protein snail homolog 2; slug homolog, zinc finger protein (chicken); SLUGH
Gene ID 6591
mRNA Refseq NM_003068
Protein Refseq NP_003059
MIM 602150
UniProt ID O43623
Chromosome Location 8q11
Pathway Adherens junction; Direct p53 effectors; Neural Crest Differentiation; Regulation of Wnt-mediated beta catenin signaling and target gene transcription; Signaling events mediated by Stem cell factor receptor (c-Kit)
Function RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity; chromatin binding; sequence-specific DNA binding; zinc ion binding

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNAI2 Products

Required fields are marked with *

My Review for All SNAI2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon