Recombinant Human SNAI2, GST-tagged
Cat.No. : | SNAI2-175H |
Product Overview : | Recombinant Human SNAI2 (97 a.a. - 169 a.a.) fused with GST-tag at N-terminal, was expressed in vitro wheat germ expression system. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the Snail family of C2H2-type zinc finger transcription factors. The encoded protein acts as a transcriptional repressor that binds to E-box motifs and is also likely to repress E-cadherin transcription in breast carcinoma. This protein is involved in epithelial-mesenchymal transitions and has antiapoptotic activity. Mutations in this gene may be associated with sporatic cases of neural tube defects. |
Molecular Mass : | 33.77 kDa |
Sequence : | KDHSGSESPISDEEERLQSKLSDPHAIEAEKFQCNLCNKTYSTFSGLAKHKQLHCDAQSRKSFSCKYCDKEYV |
Purification : | Glutathione Sepharose 4 Fast Flow |
Storage buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Applications : | ELISA; WB |
Storage : | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Note : | Best use within three months from the date of receipt of this protein. |
OfficialSymbol : | SNAI2 |
Gene Name | SNAI2 snail homolog 2 (Drosophila) [ Homo sapiens ] |
Synonyms | SLUG; WS2D; SLUGH1; SNAIL2; zinc finger protein SNAI2; protein snail homolog 2; neural crest transcription factor SLUG; slug (chicken homolog), zinc finger protein; snail homolog 2 (Drosophila); Neural crest transcription factor Slug; Protein snail homolog 2; slug homolog, zinc finger protein (chicken); SLUGH |
Gene ID | 6591 |
mRNA Refseq | NM_003068 |
Protein Refseq | NP_003059 |
MIM | 602150 |
UniProt ID | O43623 |
Chromosome Location | 8q11 |
Pathway | Adherens junction; Direct p53 effectors; Neural Crest Differentiation; Regulation of Wnt-mediated beta catenin signaling and target gene transcription; Signaling events mediated by Stem cell factor receptor (c-Kit) |
Function | RNA polymerase II core promoter proximal region sequence-specific DNA binding transcription factor activity involved in negative regulation of transcription; RNA polymerase II distal enhancer sequence-specific DNA binding transcription factor activity; chromatin binding; sequence-specific DNA binding; zinc ion binding |
◆ Recombinant Proteins | ||
SNAI2-58H | Recombinant Human SNAI2, His-tagged | +Inquiry |
SNAI2-4355R | Recombinant Rhesus monkey SNAI2 Protein, His-tagged | +Inquiry |
SNAI2-15661M | Recombinant Mouse SNAI2 Protein | +Inquiry |
SNAI2-2711H | Recombinant Human SNAI2 protein, His-tagged | +Inquiry |
SNAI2-4171R | Recombinant Rhesus Macaque SNAI2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNAI2-1642HCL | Recombinant Human SNAI2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNAI2 Products
Required fields are marked with *
My Review for All SNAI2 Products
Required fields are marked with *