Creative BioMart to Present at
                        BIO-Europe Spring Creative BioMart to Present at AACR Annual Meeting|Apr. 5-10, 2024|Booth #2953

Recombinant Human chemokine (C-X-C motif) ligand 2, His-tagged

Cat.No. : CXCL2-224H
Product Overview : GRO-Beta Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide ch- ain containing 94 amino acids and having a molecular mass of 10.1 kDa. The GRO-b is fused to 20 amino acid His Tag at N-terminus and purified by proprietary chromatographic techniques.
  • Specification
  • Gene Information
  • Related Products
Cat. No. : CXCL2-224H
Description : Chemokine (C-X-C motif) ligand 2 (CXCL2) is a small cytokine belonging to the CXC chemokine family that is also called macrophage inflammatory protein 2-alpha (MIP2-alpha), Growth-regulated protein beta (Gro-beta) and Gro oncogene-2 (Gro-2). CXCL2 is 90% identical in amino acid sequence as a related chemokine, CXCL1. This chemokine is secreted by monocytes and macrophages and is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. The gene for CXCL2 is located on human chromosome 4 in a cluster of other CXC chemokines. CXCL2 mobilizes cells by interacting with a cell surface chemokine receptor called CXCR2.
Source : Human
Host : Escherichia Coli.
Form : The Human CXCL2 protein solution contains 20mM Tris HCl.
Purity : Greater than 95.0% as determined by SDS-PAGE.
Physical Appearance : Sterile filtered colorless solution.
Amino acid sequence : MGSSHHHHHHSSGLVPRGSHMAPLATELRCQCLQTLQGILKNIQSVK VKSPGPHCAQTVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Storage : Lyophilized Bone Morphogenetic Protein-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP2 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name : CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ]
Official Symbol : CXCL2
Synonyms : CXCL2; GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a; MIP2-alpha; MIP-2a; Gro-beta; C-X-C motif chemokine 2; GRO2 oncogene; Growth-regulated protein beta; MGSA beta; chemokine (C-X-C motif) ligand 2; melanoma growth stimulatory activity beta; MIP2A_HUMAN; Macrophage inflammatory protein 2-alpha [Precursor]; Gro-beta
Gene ID : 2920
mRNA Refseq : NM_002089
Protein Refseq : NP_002080
MIM : 139110
UniProt ID : P19875
Chromosome Location : 4q21
Pathway : Cytokine-cytokine receptor interaction
Function : chemokine activity

For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Inquiry

  • Q&As
  • Reviews

Q&As (0)

Ask a question

Customer Reviews (0)

Write a review

Ask a Question for All CXCL2 Products

Required fields are marked with *

My Review for All CXCL2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon
logo

FOLLOW US

Terms and Conditions        Privacy Policy

Copyright © 2024 Creative BioMart. All Rights Reserved.

Contact Us

  • /

Stay Updated on the Latest Bioscience Trends