"CXCL2" Related Products

Expand
Expand

Recombinant Human chemokine (C-X-C motif) ligand 2, His-tagged

Cat. No.: CXCL2-224H
Product Overview: GRO-Beta Human Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide ch- ain containing 94 amino acids and having a molecular mass of 10.1 kDa. The GRO-b is fused to 20 amino acid His Tag at N-terminus and purified by proprietary chromatographic techniques.
Description: Chemokine (C-X-C motif) ligand 2 (CXCL2) is a small cytokine belonging to the CXC chemokine family that is also called macrophage inflammatory protein 2-alpha (MIP2-alpha), Growth-regulated protein beta (Gro-beta) and Gro oncogene-2 (Gro-2). CXCL2 is 90% identical in amino acid sequence as a related chemokine, CXCL1. This chemokine is secreted by monocytes and macrophages and is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. The gene for CXCL2 is located on human chromosome 4 in a cluster of other CXC chemokines. CXCL2 mobilizes cells by interacting with a cell surface chemokine receptor called CXCR2.
Source: Human
Host: Escherichia Coli.
Form: The Human CXCL2 protein solution contains 20mM Tris HCl.
Purity: Greater than 95.0% as determined by SDS-PAGE.
Physical Appearance: Sterile filtered colorless solution.
Amino acid sequence: MGSSHHHHHHSSGLVPRGSHMAPLATELRCQCLQTLQGILKNIQSVK VKSPGPHCAQTVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Storage: Lyophilized Bone Morphogenetic Protein-2 although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution BMP2 should be stored at 4°C between 2-7 days and for future use below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Gene Name: CXCL2 chemokine (C-X-C motif) ligand 2 [ Homo sapiens ]
Official Symbol: CXCL2
Synonyms: CXCL2; GRO2; GROb; MIP2; MIP2A; SCYB2; MGSA-b; MIP-2a; CINC-2a; MIP2-alpha; MIP-2a; Gro-beta; C-X-C motif chemokine 2; GRO2 oncogene; Growth-regulated protein beta; MGSA beta; chemokine (C-X-C motif) ligand 2; melanoma growth stimulatory activity beta; MIP2A_HUMAN; Macrophage inflammatory protein 2-alpha [Precursor]; Gro-beta
Gene ID: 2920
mRNA Refseq: NM_002089
Protein Refseq: NP_002080
MIM: 139110
UniProt ID: P19875
Chromosome Location: 4q21
Pathway: Cytokine-cytokine receptor interaction
Function: chemokine activity

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.