"CXCL2" Related Products

Expand
Expand

Recombinant Human CXCL2 protein

Cat.No. : CXCL2-476H
Product Overview : Recombinant Human CXCL2 protein was expressed in Escherichia coli.
Description : CXCL2, also named GRO-β, is belonging to the CXC chemokine family. It is encoded by the gene CXCL2 in humans. CXCL2/GRO-β shares 90 % amino acid sequence with CXCL1/GRO-α. All three human GROs (GRO-α, GRO-β, GRO-γ) are members of the intercrine alpha (chemokine C-X-C) subfamily of chemokine. This chemokine is secreted by monocytes and macrophages. The functional receptor for CXCL2 has been identified as CXCR2. CXCL2 is chemotactic for polymorphonuclear leukocytes and hematopoietic stem cells. Similar to other GRO proteins, CXCL2 is potent neutrophil attractants and activators. In addition, it is also active toward basophils.
Source : E.coli
Species : Human
Form : Lyophilized from a 0.2μm filtered concentrated solution in 20 mM PB, pH 7.4, 50 mM NaCl.
Bio-activity : Fully biologically active when compared to standard. The biological activity determined by a chemotaxis bioassay using human CXCR2 transfected human 293 cells is in a concentration range of 10-100 ng/ml.
Molecular Mass : Approximately 7.9 kDa, a single non-glycosylated polypeptide chain containing 73 amino acids.
Protein length : 73
AA Sequence : APLATELRCQCLQTLQGIHLKNIQSVKVKSPGPHCAQTEVIATLKNGQKACLNPASPMVKKIIEKMLKNGKSN
Endotoxin : Less than 1 EU/µg of rHuGRO-β/CXCL2 as determined by LAL method.
Purity : >97% by SDS-PAGE and HPLC analysis.
Storage : Use a manual defrost freezer and avoid repeated freeze-thaw cycles. 12 months from date of receipt, -20 to -70 centigrade as supplied. 1 month, 2 to 8 centigrade under sterile conditions after reconstitution. 3 months, -20 to -70 centigrade under sterile conditions after reconstitution.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Reconstitute in sterile distilled water or aqueous buffer containing 0.1 % BSA to a concentration of 0.1-1.0 mg/mL. Stock solutions should be apportioned into working aliquots and stored at ≤-20 centigrade. Further dilutions should be made in appropriate buffered solutions.
Gene Name : CXCL2
Official Symbol : CXCL2
Synonyms : CXCL2; chemokine (C-X-C motif) ligand 2; GRO2, GRO2 oncogene; C-X-C motif chemokine 2; CINC 2a; GROb; MGSA b; MIP 2a; SCYB2; gro-beta; MGSA beta; MIP2-alpha; GRO2 oncogene; growth-regulated protein beta; macrophage inflammatory protein 2-alpha; melanoma growth stimulatory activity beta; GRO2; MIP2; MIP2A; MGSA-b; MIP-2a; CINC-2a;
Gene ID : 2920
mRNA Refseq : NM_002089
Protein Refseq : NP_002080
MIM : 139110
UniProt ID : P19875

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.