"fur" Related Products

Recombinant E.Coli Ferric Uptake Regulator

Cat. No.: fur-4363E
Product Overview: Ferric Uptake Regulator Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 148 amino acids and having a molecular mass of 16 kDa.
Description: Ferric Uptake Regulator protein NCBI Accession No.: NP_415209 is a DNA-binding protein which controls iron-responsive genes. Ferric Uptake Regulator has a molecular mass of 17-kDa and plays a role in global transcriptional repressor that in the existence of iron regulates functions as diverse as iron acquisition, oxidative stress, and virulence. In Escherichia coli, members of the Ferric Uptake Regulator family regulate the expression of at least 100 genes that function in processes as diverse as the biosynthesis and transport of siderophores, the expression of virulence factors, the alleviation of oxidative and NO-induced stress, and the inhibition of ferritin production through the expression of RyhB.
Source: Escherichia Coli
Host: Escherichia Coli
Form: The Ferric Uptake Regulator protein solution contains 20mM Tris pH-8, 2mM CaCl2, and 100mM NaCl.
Purity: Greater than 90.0% as determined by (a) Analysis by RP-HPLC; (b) Analysis by SDS-PAGE.
Physical Appearance: Sterile Filtered colorless solution.
Amino Acid Sequence: MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYK RLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEG GKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQ REIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK.
Storage: Ferric Uptake Regulator although stable 4°C for 4 weeks, should be stored desiccated below -18°C. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Please prevent freeze-thaw cycles.
Functions: transcription repressor activity
Gene Name: fur DNA-binding transcriptional dual regulator of siderophore biosynthesis and transport [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol: fur
Synonyms: fur; ECs0714; Ferric uptake regulation protein; Ferric uptake regulator; Z0831; FUR; ECK0671; JW0669; b0683
Gene ID: 945295
Protein Refseq: NP_415209
UniProt ID: P0A9A9

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.