"fur" Related Products

Recombinant E. coli fur Protein

Cat.No. : fur-4552E
Product Overview : Escherichia coli fur (NP_415209, 1 a.a. - 148 a.a.) full-length recombinant protein expressed in Escherichia coli.
Description : Fur translation in coupled to the translation of the upstream leader pepidie Uof; Uof translation is inhibited by the antisense sRNA ryhB; Uof translation opens up a hairpin that blocks Fur translation (Vecerek, 2007). [More information is available at EcoGene: EG10359].
Source : E. coli
Species : E. coli
Form : Liquid
Molecular Mass : 42 kDa
AA Sequence : MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 1 mg/mL
Storage Buffer : In 20 mM Tris, 2 mM CaCl2, 100mM NaCl, pH 8.0
Quality Control Testing :

15% SDS-PAGE Stained with Coomassie Blue

Gene Name : fur ferric iron uptake regulon transcriptional repressor; autorepressor [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol : fur
Synonyms : fur; ferric iron uptake regulon transcriptional repressor; autorepressor; ECK0671; JW0669; ferric iron uptake regulon transcriptional repressor; autorepressor; NP_415209.1; negative regulator
Gene ID : 945295

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.