Recombinant E. coli fur Protein

Cat.No. : fur-4552E
Product Overview : Escherichia coli fur (NP_415209, 1 a.a. - 148 a.a.) full-length recombinant protein expressed in Escherichia coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : E.coli
Source : E.coli
Tag : Non
Description : Fur translation in coupled to the translation of the upstream leader pepidie Uof; Uof translation is inhibited by the antisense sRNA ryhB; Uof translation opens up a hairpin that blocks Fur translation (Vecerek, 2007). [More information is available at EcoGene: EG10359].
Form : Liquid
Molecular Mass : 42 kDa
AA Sequence : MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK
Purity : > 95% by SDS-PAGE
Applications : SDS-PAGE
Storage : Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Concentration : 1 mg/mL
Storage Buffer : In 20 mM Tris, 2 mM CaCl2, 100mM NaCl, pH 8.0
Gene Name fur ferric iron uptake regulon transcriptional repressor; autorepressor [ Escherichia coli str. K-12 substr. MG1655 ]
Official Symbol fur
Synonyms fur; ferric iron uptake regulon transcriptional repressor; autorepressor; ECK0671; JW0669; ferric iron uptake regulon transcriptional repressor; autorepressor; NP_415209.1; negative regulator
Gene ID 945295

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All fur Products

Required fields are marked with *

My Review for All fur Products

Required fields are marked with *

0
cart-icon
0
compare icon