Recombinant E. coli fur Protein
Cat.No. : | fur-4552E |
Product Overview : | Escherichia coli fur (NP_415209, 1 a.a. - 148 a.a.) full-length recombinant protein expressed in Escherichia coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | Non |
Description : | Fur translation in coupled to the translation of the upstream leader pepidie Uof; Uof translation is inhibited by the antisense sRNA ryhB; Uof translation opens up a hairpin that blocks Fur translation (Vecerek, 2007). [More information is available at EcoGene: EG10359]. |
Form : | Liquid |
Molecular Mass : | 42 kDa |
AA Sequence : | MTDNNTALKKAGLKVTLPRLKILEVLQEPDNHHVSAEDLYKRLIDMGEEIGLATVYRVLNQFDDAGIVTRHNFEGGKSVFELTQQHHHDHLICLDCGKVIEFSDDSIEARQREIAAKHGIRLTNHSLYLYGHCAEGDCREDEHAHEGK |
Purity : | > 95% by SDS-PAGE |
Applications : | SDS-PAGE |
Storage : | Store at -20 centigrade. For long term storage store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Concentration : | 1 mg/mL |
Storage Buffer : | In 20 mM Tris, 2 mM CaCl2, 100mM NaCl, pH 8.0 |
Gene Name | fur ferric iron uptake regulon transcriptional repressor; autorepressor [ Escherichia coli str. K-12 substr. MG1655 ] |
Official Symbol | fur |
Synonyms | fur; ferric iron uptake regulon transcriptional repressor; autorepressor; ECK0671; JW0669; ferric iron uptake regulon transcriptional repressor; autorepressor; NP_415209.1; negative regulator |
Gene ID | 945295 |
◆ Recombinant Proteins | ||
fur-4363E | Recombinant E.Coli Ferric Uptake Regulator | +Inquiry |
fur-4552E | Recombinant E. coli fur Protein | +Inquiry |
FUR-0125B | Recombinant Bacillus subtilis FUR protein, His-tagged | +Inquiry |
fur-5718E | Recombinant Escherichia coli (strain K12) fur protein, His-tagged | +Inquiry |
fur-4236E | Recombinant Escherichia coli fur protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All fur Products
Required fields are marked with *
My Review for All fur Products
Required fields are marked with *