Recombinant Rat Interleukin-1 beta Il1b-463R

Recombinant Rat Interleukin-1 beta

PRODUCTS

Home / Products / Recombinant Proteins / Recombinant Rat Interleukin-1 beta

Recombinant Rat Interleukin-1 beta

Il1b Related Products

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.

Cat. No. : Il1b-463R
Product Overview : Recombinant Rat IL-1μ is a non-glycosylated single polypeptide chain containing 152 amino acids and having a molecular mass of 17,303 Daltons
Description : Interleukin-1beta (IL-1μ) is a proinflammatory cytokine produced in response to inflammatory agents by a variety of cells, including monocytes, macrophages, and dendritic cells (DCs). IL-1μ and IL-1μ are two distinct and independently regulated gene products that comprise IL-1 and signal through the Type 1 IL-1 receptor (IL-1R1). Although IL-1μ is cell associated and IL-1μ is secreted, they have nearly identical biological activity in that they induce adhesion molecule expression on epithelial cells, control fever induction, and play a role in arthritis and septic shock. Signaling activated by the IL-1R1 promotes these activities through a MYD88 signaling pathway similar to those associated with Toll receptors.
Species : Rat
Source : E.coli
Form : Lyopohilized from 10 mM NaP, pH 7.5.
Purity : Purity Greater than 97% as determined by: Analysis by RP-HPLC. Reducing and non-reducing SDS-PAGE.
Bio-activity : Rat IL-1b is fully biologically active when compared to a standard. The ED50, as determined by the dose-dependent proliferation of mouse D10S cells, is 40.2 pg/ml.
Physical Appearance : Sterile Filtered white lyophilized (freeze-dried) powder.
Solubility : It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mgμs/ml, which can be further diluted into other aqueous solutions.
Purity Greater than 97% as determined by : Analysis by RP-HPLC. Reducing and non-reducing SDS-PAGE.
Protein Content determined by : UV spectroscopy at 280 nm. Analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Endotoxin Level : Endotoxin level is <0.01ng/ug or <0.1EU/ug.
Amino acid sequence : VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTL QLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
Storage : Lyophilized product is very stable at -20 degrees. Reconstituted material should be aliquoted and frozen at -20. It is recommended to add a carrier protein (0.1% HSA or BSA) for long term storage.
PDB rendering basedon 31bi. :

Gene Name : Il1b interleukin 1 beta [ Rattus norvegicus ]
Official Symbol : Il1b
Synonyms : Il1b; interleukin 1 beta; interleukin 1, beta ; IMAGE:7365029; MGC:108658
Gene ID : 24494
mRNA Refseq : NM_031512
Protein Refseq : NP_113700
UniProt ID : Q63264
Chromosome Location : 3q36
Pathway : Alzheimer"s disease; Apoptosis; Cytokine-cytokine receptor interaction; Graft-versus-host disease; Hematopoietic cell lineage; MAPK signaling pathway; Prion diseases; Toll-like receptor signaling pathway; Type I diabetes mellitus
Function : cytokine activity; growth factor activity; interleukin-1 receptor binding; protein domain specific binding

Online Inquiry


  • Note: There will be extra charge for optional service!
  • Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional Service: Optional requirements on this protein

Other Requirements:

Apply For A Coupon

$50 OFF Your First Purchase

Apply For a Coupon

Enter your email here to subscribe.

creative biomart inc.

Easy access to products and services you need from our library via powerful searching tools.

Follow Us

Copyright © 2007 – 2020 Creative BioMart. All Rights Reserved. Terms and Conditions | Privacy Policy