"Il1b" Related Products

Expand
Expand

Recombinant Rat Interleukin-1 beta

Cat. No.: Il1b-463R
Product Overview: Recombinant Rat IL-1μ is a non-glycosylated single polypeptide chain containing 152 amino acids and having a molecular mass of 17,303 Daltons
Description: Interleukin-1beta (IL-1μ) is a proinflammatory cytokine produced in response to inflammatory agents by a variety of cells, including monocytes, macrophages, and dendritic cells (DCs). IL-1μ and IL-1μ are two distinct and independently regulated gene products that comprise IL-1 and signal through the Type 1 IL-1 receptor (IL-1R1). Although IL-1μ is cell associated and IL-1μ is secreted, they have nearly identical biological activity in that they induce adhesion molecule expression on epithelial cells, control fever induction, and play a role in arthritis and septic shock. Signaling activated by the IL-1R1 promotes these activities through a MYD88 signaling pathway similar to those associated with Toll receptors.
Species: Rat
Source: E.coli
Form: Lyopohilized from 10 mM NaP, pH 7.5.
Purity: Purity Greater than 97% as determined by: Analysis by RP-HPLC. Reducing and non-reducing SDS-PAGE.
Bio-activity: Rat IL-1b is fully biologically active when compared to a standard. The ED50, as determined by the dose-dependent proliferation of mouse D10S cells, is 40.2 pg/ml.
Physical Appearance: Sterile Filtered white lyophilized (freeze-dried) powder.
Solubility: It is recommended to reconstitute the lyophilized product with sterile water at a concentration of 0.1 mgμs/ml, which can be further diluted into other aqueous solutions.
Purity Greater than 97% as determined by: Analysis by RP-HPLC. Reducing and non-reducing SDS-PAGE.
Protein Content determined by: UV spectroscopy at 280 nm. Analysis by RP-HPLC calibrated against a known standard. Quantitation on SDS-PAGE against a known standard.
Endotoxin Level: Endotoxin level is <0.01ng/ug or <0.1EU/ug.
Amino acid sequence: VPIRQLHCRLRDEQQKCLVLSDPCELKALHLNGQNISQQVVFSMSFVQGETSNDKIPVALGLKGLNLYLSCVMKDGTPTL QLESVDPKQYPKKKMEKRFVFNKIEVKTKVEFESAQFPNWYISTSQAEHRPVFLGNSNGRDIVDFTMEPVSS
Storage: Lyophilized product is very stable at -20 degrees. Reconstituted material should be aliquoted and frozen at -20. It is recommended to add a carrier protein (0.1% HSA or BSA) for long term storage.
Gene Name: Il1b interleukin 1 beta [ Rattus norvegicus ]
Official Symbol: Il1b
Synonyms: Il1b; interleukin 1 beta; interleukin 1, beta ; IMAGE:7365029; MGC:108658
Gene ID: 24494
mRNA Refseq: NM_031512
Protein Refseq: NP_113700
UniProt ID: Q63264
Chromosome Location: 3q36
Pathway: Alzheimer"s disease; Apoptosis; Cytokine-cytokine receptor interaction; Graft-versus-host disease; Hematopoietic cell lineage; MAPK signaling pathway; Prion diseases; Toll-like receptor signaling pathway; Type I diabetes mellitus
Function: cytokine activity; growth factor activity; interleukin-1 receptor binding; protein domain specific binding

Online Inquiry

Note: There will be extra charge for optional service!

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information

Optional requirements on this protein    +Expand

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.