Recombinant Full Length Human S100A8 Protein, His-tagged
| Cat.No. : | S100A8-3732H |
| Product Overview : | S100A8;S100 calcium binding protein A8;MRP8;Calgranulin A;CAGA;CFAG;P8;His-tagged;Human |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E. coli |
| Tag : | His |
| Protein Length : | 1-93 aa |
| Description : | S100A8 (S100 calcium binding protein A8), also known as MRP8 or Calgranulin A, is a calcium- and zinc-binding EF-hand protein predominantly expressed in myeloid cells including neutrophils and monocytes. It forms a heterodimer complex with S100A9 (Calprotectin) and plays critical roles in inflammatory responses, antimicrobial defense, cytoskeleton rearrangement, and arachidonic acid metabolism regulation. |
| Form : | Liquid |
| Molecular Mass : | 12 kDa (calculated) |
| AASequence : | MKHHHHHHASMLTELEKALNSIIDVYHKYSLIKGNFHAVYRDDLKKLLETECPQYIRKKGADVWFKELDINTDGAVNFQEFLILVIKMGVAAHKKSHEESHKE |
| Endotoxin : | <1.0 EU/ug (by LAL) |
| Purity : | >90% (by SDS-PAGE) |
| Storage : | Store under sterile conditions at -20°C to -80°C, aliquot, avoid repeated freeze-thaw cycles |
| Concentration : | 1 mg/ml (by BCA) |
| Storage Buffer : | Sterile PBS, pH7.4 |
| Gene Name | S100A8 |
| Official Symbol | NM_002964.5 |
| Synonyms | NP_002955.2 |
| Gene ID | https://www.ncbi.nlm.nih.gov/protein/NP_002955.2 |
| mRNA Refseq | https://www.uniprot.org/uniprotkb/P05109 |
| Protein Refseq | https://www.ncbi.nlm.nih.gov/gene/6279 |
| MIM | https://www.omim.org/entry/123885 |
| ◆ Recombinant Proteins | ||
| S100A8-7868M | Recombinant Mouse S100A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| S100a8-129M | Recombinant Mouse S100a8 protein (Met1-Glu89), His-tagged | +Inquiry |
| S100A8-6220H | Recombinant Human S100A8 Protein (Met1-Glu93), C-His tagged | +Inquiry |
| S100A8-3881R | Recombinant Rhesus Macaque S100A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
| S100A8-7451H | Recombinant Human S100A8 protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| S100A8-685HCL | Recombinant Human S100A8 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A8 Products
Required fields are marked with *
My Review for All S100A8 Products
Required fields are marked with *



